KEGG   Streptomyces avermitilis: SAV_3159Help
Entry
SAV_3159          CDS       T00126                                 

Gene name
nrps3-3
Definition
(GenBank) putative non-ribosomal peptide synthetase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(3934439..3937489)
Genome map
AA seq 1016 aa AA seqDB search
MAYRLRGTLDVGALHRALTSLVTRNTALRTTFRSAEGTPYGVVAPAGEVDLEIVDLADAD
LDATLRARSEAPFDLAAGPLYRFSLLRLSAEDHVLVLVFHHINTDGWSSALINREISGAY
NAFVQGTQPALPELEATYEDHVRAQREQHGGDSWEQQLKFWKGKLAGLPVVEMPADRARP
ATPTQNGETLTFDFPAELLHGARALAQQEGASLFMVLTTALNVVVGRYTGQEDIPLGIPM
LGRTEPELEDVVGLFINMLVLRTDLSGDPTFAELIERVADANMDVYDNQDVPFDQIVSHV
QPAREAGRNPLFQIGTQLLGSGTGGSDLGLTGLTDEQLDVAVPRSRYDLSLTFLESADRL
RFVAEYTTDLFDGIRIEAMARHIQNVLAAAVEDAEQPISKLAMLGEDERRLLLEAGRGPD
FDFSHDPVHTTVLQVAERTPHAVAAVCRGVEMTYGELARRSGKLARHLRARGIRPGQVVG
IVMDRDLDALVAMLGVMRAGGAYAVMDPSHPAARIDYMLQDTAAPVVITRADVAGGLPTS
EDRKVVLIDADWAAIEAESDTEPLEELADRETLAYVLYTSGSTGRPKGVMIEHRSLRVFI
EAYRHTFGEFTPEDRLLQQPSLIFDMSQGEIYTALITGATLVLVSPEDASSPEALGTLIR
EQRVTYVGLSPTLLSLLDGGPYPHLKYIMGGAEVLPAELVNKWNIPGRKFVNLYGPTEAA
IACTEYLCEHIEWRSAPPIGRPEYGRLHYVVDRHGNLAPVGVPGELLIGGEDGLARGYLN
LPELTDEKFVPNPFEPTGRVYRTGDLVRWTPDYQVDFIGRIDNQVKLRGLRIELGEIESA
LVAHPQIRMALVLLKADPQGEKQLVGYYTVLGDQAPTLAELRRHLGESMPEYMVPTAWVK
LDEFPLTLAKKIDRHALPEPSYGADGTEGRAYVAPATPTEERVAEAFATVLKADQISADA
SFFELGGNSLQAMRAVSRINKAFGVKINVRMLYGGATVGGVAEAIDELLAAKAGRD
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtaccggctgcgcggcaccctcgacgtcggggccctgcaccgggcgctgacctcc
ctggtcacccgtaacacggcgctgcgcacgaccttccgctccgccgagggcaccccgtac
ggcgtcgtcgcgcccgcgggcgaggtcgacctggagatcgtcgacctggcggacgccgac
ctggacgcaactctgcgcgcccgcagcgaggcccccttcgacctggcggccgggccgctg
taccgcttctcgctgctgcggctgtccgccgaggaccacgtcctggtgctggtcttccac
cacatcaacaccgacggctggtcgtcggccctgatcaaccgcgagatctccggcgcctac
aacgccttcgtccagggcacgcagcccgcgctccccgagctggaggcgacgtacgaggac
cacgtccgggcccagcgcgagcagcacgggggcgactcctgggagcagcagctgaagttc
tggaaggggaagctcgccgggctgccggtggtggagatgcccgccgaccgcgcgcgtccg
gccaccccgacccagaacggcgagaccctcaccttcgacttccccgccgaactgctccac
ggggcgcgggcgctcgcgcagcaggagggcgcctccctgttcatggtgctgacgaccgcc
ctgaacgtcgtggtcggccgctacaccggccaggaggacatcccgctcggcatccccatg
ctcggccgcacggagcccgaactcgaggacgtcgtcggcctgttcatcaacatgctggtg
ctgcgcaccgatctgtccggcgaccccaccttcgccgagctgatcgagcgggtcgcggac
gccaacatggacgtgtacgacaaccaggacgtgccgttcgaccagatcgtcagccatgtc
cagccggcccgtgaggcgggccgcaacccgctgttccagatcggcacccagctgctcggc
agcggcaccgggggttccgacctgggcctgaccgggctcaccgacgaacagctggacgtc
gccgtcccgcgctcccgctacgacctgtcgctgacgttcctggagagcgcggaccggctg
cggttcgtcgccgagtacaccaccgacctgttcgacggcatccgcatcgaggcgatggcc
cggcacatccagaacgtgctggccgccgcggtcgaggacgccgagcagccgatctccaag
ctggcgatgctcggcgaggacgagcgccggctgctgctggaggcgggccgcggcccggac
ttcgacttcagccacgacccggtgcacaccaccgtcctccaggtcgccgagcgcaccccc
cacgccgtcgccgcggtctgccgcggggtggagatgacgtacggcgaactggcgcgccgc
tccggcaagctcgcccgccatctgcgggcccgcgggatacgccccggacaggtcgtcggc
atcgtcatggaccgcgacctggacgccctggtggccatgctgggcgtcatgcgggccggc
ggcgcctacgcggtcatggacccctcgcacccggccgcccgtatcgactacatgctccag
gacaccgcggccccggtcgtcatcacccgcgccgatgtggcgggcgggctcccgacgagc
gaggaccggaaggtcgtgctcatcgacgcggactgggcggccatcgaggccgagtccgac
accgagccgctcgaagagctcgcggaccgcgagaccctcgcctacgtcctctacacctcg
ggctccaccggccgccccaagggcgtgatgatcgagcaccgcagcctgcgcgtgttcatc
gaggcgtaccggcacacgttcggcgaattcacccccgaggaccggctgctccagcagccg
tcgctgatcttcgacatgtcgcagggcgagatctacaccgcgctgatcaccggcgccacg
ctggtcctcgtctcgcccgaggacgcctcgtcgcccgaggcgctcggcaccctcatccgc
gagcagcgcgtcacctatgtcggtctctcgccgaccctgctctcgctgctcgacggcgga
ccgtacccgcacctgaaatacatcatgggcggcgccgaggtcctgccggccgagctggtc
aacaagtggaacatccccggccgcaagttcgtgaacctgtacggcccgaccgaggcggcc
atcgcctgcaccgagtacctctgcgagcacatcgagtggcgctccgccccgccgatcggc
cgccccgagtacgggcgtctgcactacgtggtcgaccggcacggcaacctcgccccggtc
ggtgtccccggtgagctgctcatcggcggcgaggacggcctggcccgcggctatctcaac
ctgcccgagctgaccgacgagaagttcgtgcccaaccctttcgagcccaccggccgggtc
taccgcaccggcgacctcgtccgctggaccccggactaccaggtcgacttcatcggccgc
atcgacaaccaggtcaagctgcgcggcctgcgcatcgagctcggcgagatcgagtccgcg
ctggtcgcccacccgcagatccgcatggccctggtgctgctcaaggcggacccgcagggc
gagaagcagctcgtcggctactacacggtgctcggcgaccaggccccgaccctcgccgaa
ctccgccgccacctcggcgagtcgatgcccgagtacatggtgccgaccgcctgggtgaag
ctggacgagttcccgctcacgctcgccaagaagatcgaccggcacgcgctgcccgagccg
tcgtacggcgccgacggtacggaaggccgggcctacgtcgcccccgccacgcccaccgag
gagcgggtcgccgaggccttcgccacggtcctgaaggccgatcagatcagcgcggacgcc
agcttcttcgaactcggcggcaactcgctccaggcgatgcgggcggtcagccggatcaac
aaggccttcggcgtgaagatcaacgtccggatgctctacggcggcgccaccgtgggcggc
gtggccgaggccatcgacgaactgctcgccgccaaggccggccgtgactga

DBGET integrated database retrieval system