KEGG   Streptomyces avermitilis: SAV_3806Help
Entry
SAV_3806          CDS       T00126                                 

Gene name
fadD16
Definition
(GenBank) putative acyl-CoA synthetase, fatty acid:CoA ligase
  KO
K18687  
HIP---CoA ligase [EC:6.2.1.41]
Organism
sma  Streptomyces avermitilis
Pathway
Steroid degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SAV_3806 (fadD16)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.41  3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoate---CoA ligase
     SAV_3806 (fadD16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(4708540..4710123)
Genome map
AA seq 527 aa AA seqDB search
MRGDVEWGSIPGLVRSSAERYADTEAVVEGRTRISYAELGARVERAAAACIASGVGVGDR
VGIWAPNSLDWIVSALGAVSAGAVLVPLNTRFKGSEAAYVLRRSGARLLFVTGTFLGTSY
VASLRRAAGEGEGLRGPLPGLPALEQVVVLADDAPADFRTWKDFLASGEGVGEAETRERA
RGLDGSTVSDIIFTSGTTGRPKGAVITHAQTLRAYEVWSDLAGLRRGDRYLIANPFFHTF
GYKAGVIACLMRGATMIPQPVFNVDTVLANIAAERVSVLPGPPTLHQSLLDHPARDAYDL
SALRLVVTGAAVVPLRLVERLRGELGVGTVLTAYGLSEASGIVTMCRRGDDPSVIASTSG
RAIPGTEVRVEAPLGSPGEVLVRGFNVMRGYFEDERATAAALTEDGWLRTGDVGVLDASG
NLRITDRIKDMFIVGGFNAYPAEIEQLLGLHPDVADVAVIGVPDARLGEVGKAYVVRRPG
SVLTGDDLIAWSRREMANYKVPRAVEFVGELPRNAGGKVVKGELRGR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggagacgtggagtggggcagcatcccgggcctggtgcggtcgtccgcggagcgg
tacgcggataccgaggcggtggtggagggccgtacgaggatctcgtacgccgagttgggc
gcccgggtggagcgtgcggcggcggcgtgtatcgccagcggggtgggtgtcggcgaccgg
gtgggcatctgggcgccgaattcgctggactggatcgtctcggcgctgggcgcggtgtcg
gcgggcgcggtactggtgccgctgaacacgcgcttcaaggggagcgaggcggcttatgtt
ctgcggcggagcggggcgcggttgctgttcgtgaccgggacgtttctgggcacgtcgtac
gtggcttcgctgcggcgggcggcgggggagggcgaggggctccgtggtcccctgcccggg
cttcccgccctggagcaggtggtggtgctggcggacgacgcgccggccgacttccgtacg
tggaaggacttcctggcgagcggggagggggtgggcgaggcggagacgcgggagcgagcg
cgggggctggacggctcgacggtctcggacatcatcttcacgtcgggtacgacgggccgc
ccgaagggcgcggtgatcacgcacgcgcagacgttgcgggcgtacgaggtgtggagcgac
ctggcgggcctgcgccggggtgaccgctacctgatcgcgaaccccttcttccacaccttc
ggctacaaggcgggagtgatcgcctgcttgatgcgaggcgcgacgatgatcccgcagccg
gtgttcaacgtggacacggtgctggcgaacatcgccgcggaacgggtctccgtactaccg
ggcccgcctaccctgcaccagtccctgctggaccatccggcccgggacgcgtacgacctg
tcggcgctgcggctggtggtgaccggggcggcggtggtgccgttgcggctggtggagcgg
ttgcggggggagttgggggtgggaaccgtgctcacggcgtacggcctctcggaggccagc
ggcatcgtcacgatgtgccgtcggggcgacgatccgtccgtgatcgcgtcgacgtcgggg
cgcgcgattcccggtacggaggtccgtgtggaggcgccgctcggctcccccggggaggtc
ctggtccgcggcttcaacgtgatgcggggctacttcgaggacgagcgggccacggcggcg
gcgctgacggaggacggctggctcaggacgggcgacgtgggcgtcctggacgcgtccggc
aatctccggatcacggaccggatcaaggacatgttcatcgtcggcggcttcaacgcctac
cccgccgagatagagcaactgctcggcctgcacccggatgtggcggacgtggcggtgatc
ggcgtaccggacgcacgcctcggcgaggtgggcaaggcgtacgtggtccgccgcccgggt
tccgtcctgacgggggacgacctgatcgcctggtcccggcgcgagatggcgaactacaag
gtgccgcgggcggtggagttcgtgggggagctgccgcggaacgctggcgggaaggtggtg
aagggggagttgcgggggcggtga

DBGET integrated database retrieval system