KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_1998Help
Entry
SMDB11_1998       CDS       T03985                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac00010  Glycolysis / Gluconeogenesis
smac01100  Metabolic pathways
smac01110  Biosynthesis of secondary metabolites
smac01120  Microbial metabolism in diverse environments
smac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMDB11_1998
Enzymes [BR:smac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SMDB11_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CDG12574
LinkDB All DBs
Position
2116573..2117448
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVSEQISPYISQRQLDELGVVVVSHPKVRAAVALQGAHLLAWQPSGEQPVIW
LSNNTPFAKGKAIRGGVPICWPWFGPVAQPSHGFARNQPWSLTAHDEDDNGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGAECEIELESHGDYQATAALHSYFQVGDIERVSVAGLGEP
YIDKVAGGAEARQAGEVTFVGQTDRVYTRPEAFSQIRDPALARTIEVHHHHMSDVIAWNP
GAELSCSMGDMPNDGYKTMVCIETGRVSKPLIAAGEQPARLGVTFRSRKKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaaattttcaccctgcccgtttccgaacagatttcaccttacatcagccaa
cgtcagctcgatgagctgggcgtggtggtggtctcgcacccgaaagtgcgcgcggccgtc
gcgctgcagggcgcccatttgctggcctggcagcccagcggtgagcagccggtaatttgg
ctcagcaacaataccccgtttgccaaaggcaaggccatccgcggtggggtaccgatctgc
tggccgtggttcggtccagtggcgcaaccctcccacggctttgcccgtaaccagccctgg
agcctgacggcgcacgatgaagatgacaacggcgtcattctgaccttcacgctgaaagac
aatgagcagacccgaaaactgtggccgcacgccttcacgctgattgcccgcttcaaactg
ggtgcagagtgcgagatcgaactggaatcgcacggcgattatcaggccacggcggcgcta
catagctacttccaggtcggcgacatcgaacgggtcagcgtggcgggtctgggcgagcct
tatatcgacaaggtggcgggcggtgcagaggcacgtcaggcaggtgaagtgaccttcgtc
ggccaaaccgaccgtgtctatactcgcccggaggccttcagccagatccgcgatccggcg
ctcgcacgcaccatcgaggttcaccaccatcatatgagcgacgtcatcgcctggaacccc
ggcgcagaactctcctgcagcatgggggatatgccgaacgacggttacaagaccatggtt
tgtatcgagaccgggcgcgtcagcaaaccgctgatcgccgccggcgagcaacccgcccgt
ttgggagtcaccttccgcagccgtaaaaaagcctga

DBGET integrated database retrieval system