KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_3545Help
Entry
SMDB11_3545       CDS       T03985                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac00250  Alanine, aspartate and glutamate metabolism
smac00410  beta-Alanine metabolism
smac00640  Propanoate metabolism
smac00650  Butanoate metabolism
smac01100  Metabolic pathways
smac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smac00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SMDB11_3545 (puuE)
   00650 Butanoate metabolism
    SMDB11_3545 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMDB11_3545 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMDB11_3545 (puuE)
Enzymes [BR:smac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SMDB11_3545 (puuE)
Amino acid related enzymes [BR:smac01007]
 Aminotransferase (transaminase)
  Class III
   SMDB11_3545 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CDG14108
LinkDB All DBs
Position
complement(3769948..3771213)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGVGVMCGFYAERAENATLWDVEGKEVIDFASGIAVLNTGHRHPK
VIAAIEKQLQAFTHTAYQIVPYESYVSLAERINQRAPIAGPCKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLDRLFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFMQALRALCDQHGILLIADEV
QTGFARTGKLFAMEHYSVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEQLCQRAQRLGQHLVEVLQQARKTSPAIADVRAQGSMVAVEFND
PVTGKPSAEITRQVQQKAMAEGLLLLSCGVNGNVIRFLYPLTIPDDQFTKAMGILSRALA
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaattgaaccaacgccgtcaggacgccaccccgcgcggagtgggcgtg
atgtgtggtttttacgccgagcgcgcagagaacgccacgctatgggatgtggaaggcaaa
gaagtgatcgactttgcttcggggatcgccgtgctgaacaccgggcaccgtcacccgaag
gtgatcgccgcaattgaaaagcagctgcaggccttcacacacaccgcctatcagatcgtt
ccttacgaaagctatgtctcgttggcggagcgcatcaaccagcgcgcgccgatcgccggc
ccgtgtaaaaccgctttcttcaccaccggcgcggaagcggtggaaaacgcggtgaagatc
gcccgcgcttacaccggccgtccgggcttgatcaccttcggcggcggcttccacggccgc
acctatatgaccatggcgctgaccggcaaagtggcgccttacaaactgggctttggccca
ttccccggctcggtgttccacggccagtatcccaacgcgctgtacggcgtgaccaccgaa
gacgcgatgaacagcctggatcgcctgtttaaagcggatatcgatcccaagcaggtggcg
gccattgtgctggagccggtgcagggcgagggcggtttcaacgtggcgccggccgagttc
atgcaggcgctgcgcgcgctgtgcgaccagcacggcatcctgctgatcgccgacgaagtg
cagaccggcttcgcccgtaccggcaagctgttcgccatggagcactacagcgttaagccc
gatttgatcactatggcgaaaagcctggcgggcggcatgccgctgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggcgggctgggcggcacctacgccggtaac
ccgctggcggtggccgccgcgcacgcggtgctggacgtgatcgacgaagagcagctgtgc
cagcgcgctcagcgcttgggtcagcacctggtggaagtgctccagcaggcgcgcaaaacc
agcccggcgatcgccgatgtgcgcgcgcagggatcgatggtggcggtggagttcaacgat
ccggttaccggcaagccttcggcggagatcacccgtcaggtgcagcagaaggcgatggcg
gaagggctgctgctgttgagctgcggcgtgaacggcaacgtgatccgcttcctctacccg
ctgaccatcccggacgatcagttcaccaaggcgatgggcattctgtcccgcgcgctggcc
cactaa

DBGET integrated database retrieval system