KEGG   Serratia marcescens FGI94: D781_4034Help
Entry
D781_4034         CDS       T02433                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smaf  Serratia marcescens FGI94
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    D781_4034
   00650 Butanoate metabolism
    D781_4034
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D781_4034
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D781_4034
Enzymes [BR:smaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     D781_4034
Amino acid related enzymes [BR:smaf01007]
 Aminotransferase (transaminase)
  Class III
   D781_4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4268024..4269289)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQQATPRGVGVMCGFYAERAENATLWDVEGNQVIDFAAGIAVLNTGHRHPK
VLAAIEQQLQAFTHTAYQIVPYESYVSLAERINQRAPIDGPCKTAFFTTGAEAVENAVKI
ARAHTGRPGIITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALHGISTQ
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFIQALRTLCDEHGILLVADEV
QTGFARTGKLFAMEHYDSKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVMDVIDEEQLCQRAQRLGHHLVEVLQQARASCPAIAEIRAQGSMVAVEFND
PASGQPSAEFTRQVQQKALQEGLLLLSCGVHGNVIRFLYPLTIPEEQFTKALGILSRALA
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaaccaacgtcgtcagcaagccacgccacgcggggtgggagtt
atgtgtggtttttacgcagagcgggcggaaaacgccaccctgtgggatgtggaaggcaat
caagttatcgattttgcggccggcatcgcggtgctgaacaccggtcaccgtcatccgaaa
gtgctggcagcgattgagcaacagctgcaggcctttacccataccgcctaccagatcgtg
ccgtatgaaagctacgtctcactggccgagcgcatcaaccagcgcgcgccgatcgacggg
ccgtgtaagaccgccttcttcaccaccggcgccgaagcggtcgaaaacgcggtgaaaatc
gcccgcgctcataccggccgtccgggcattatcacctttggcggcggcttccacggccgc
acctatatgaccatggcgctgaccggcaaagtggcgccgtacaaactgggcttcgggccg
ttccccggctcggtgttccacggccagtacccgaacgcgctgcacggcatcagcacgcag
gacgcgatgaacagcctggagcgcatcttcaaggcggatatcgacccgaaacaggtggcg
gcgatcgtgctggagccggtgcagggcgagggcggctttaacgttgcgccggcggagttt
atccaggcgctgcgcacgctgtgcgatgagcacggcatcctgctggtggcggatgaagta
cagaccggctttgcccgtaccggcaagctgttcgccatggagcattacgacagcaaaccc
gatctgatcaccatggcgaaaagcctggcgggcggcatgccgctgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggcgggctgggcggcacctatgccggtaac
ccgctggcggtggccgcggcgcatgcggtcatggacgtgattgatgaagagcagctgtgc
cagcgcgcgcagcgtctgggtcatcatctggtggaggtgctgcagcaggcgcgcgccagc
tgtccggccatcgccgagatccgcgcgcaggggtcgatggtggcggtcgagtttaacgac
cccgccagcggccagccgtcggcggaattcacccgtcaggtacagcaaaaagccctgcag
gaaggcctgctgctgctgagctgcggcgtacacggcaacgtgatccgcttcctgtacccg
ctgaccattcctgaagaacaattcaccaaggcgctgggcattctttcccgcgcgttggct
gaataa

DBGET integrated database retrieval system