KEGG   Sphingopyxis macrogoltabida EY-1: AN936_00670Help
Entry
AN936_00670       CDS       T04104                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smag00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AN936_00670
Enzymes [BR:smag01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AN936_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
137864..139117
Genome map
AA seq 417 aa AA seqDB search
MTLDTAMLDRAACEAMDRADPLAPLRDRFDLPEGMIYLDGNSLGAMPKGAAARSHEVVTR
EWGTDLIKSWNSAGWFDLPVRLGDKLAPLVGAAPGEVVICDSTSQNLFKVLSAAAALRPG
RSVLILEGSNFPTNNYIAEGVAAATGGRVSVRLCEKDEIAGAIDDDTIAAAITHVHYKSG
HVHDMAAITARAHEAGALAIWDLCHSAGAMPVDLGGAGADFAVGCTYKYLNGGPGSPAFL
FAAKRHQGQALQPVTGWWGHAAPFAFEPGYRPQHDIRQFLIGTQPIVSMALVETGLDIHL
AADMDAIRAKSMALTDLFIRLVEARCAGHGFTLASPRDAAARGSQVSFAHAEGYPIMRAL
IAAGVIGDFRAPDTVRFGFTPLYTGYADVWDAVDRLATIMDGGIWKLPEHQVRDAVT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgatacagcaatgctcgaccgcgccgcctgcgaggcgatggaccgcgccgat
ccgctcgcgccgctgcgcgaccgcttcgacctgcccgaagggatgatctatctcgacggc
aattcgctcggcgcgatgccgaagggggccgcggcgcgttcgcacgaggtggtgacgcgc
gaatggggcaccgacctgatcaagagctggaacagcgccggctggttcgacctgccggtg
cgcctcggcgacaagctcgcgccgctggtcggcgccgcgccgggcgaggtcgtgatctgc
gattcgacgagccagaacctgttcaaggttctgtccgcggcggccgcgctgcgccccggc
cgcagcgtgctgatccttgagggcagcaattttccgaccaacaattatatcgccgagggc
gtcgccgcggcgaccggcggccgcgtatcggtgcggctgtgcgagaaggacgagatcgcc
ggcgcgatcgacgacgacacgatcgcagccgcgatcacccatgtccattacaagtcgggc
catgtccacgacatggcggcgatcaccgcccgggcgcacgaagccggcgcgctcgcgatc
tgggatctctgccacagcgcgggggcgatgccggtcgacctgggtggcgcgggcgccgat
ttcgcggtcggctgcacctacaaatatctgaacggcggtcccggctcgcccgccttcctg
ttcgcggcgaagcggcatcaggggcaggcgctgcaaccggtcaccggctggtggggccat
gccgcgcccttcgcgttcgagccgggataccggccgcagcacgacatccgccagttcctc
atcggcacgcagccgatcgtgtcgatggcactcgtcgagaccgggctcgatattcacctc
gcggccgacatggacgcgatccgcgccaagtcgatggcgctcaccgacctcttcatccgc
ctcgtcgaggcgcgctgcgcgggacacggcttcacgctcgcctcgccgcgcgacgcggcg
gcgcgcggcagccaggtgtccttcgcacatgccgagggctatccgatcatgcgcgcgctg
atcgcggcgggcgtgatcggcgatttccgcgcccccgacacggtgcgcttcggcttcacg
ccgctttataccggctatgccgatgtgtgggacgcggtcgaccggctcgccacgatcatg
gacggcggcatctggaaattgcccgagcatcaggtccgcgacgcggttacataa

DBGET integrated database retrieval system