KEGG   Sphingopyxis macrogoltabida EY-1: AN936_23345Help
Entry
AN936_23345       CDS       T04104                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Brite
Enzymes [BR:smag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AN936_23345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Phosphodiest GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALH83084
UniProt: A0A0N9UH55
LinkDB All DBs
Position
p1:complement(72933..73613)
Genome map
AA seq 226 aa AA seqDB search
MIDLYFWPTPNGYKAAIMLAESGLDYRVIPVDITAGEQFHPEFLKINPNNKVPAIVDHDG
PHNKPYAVFESAVVLIYLAEKSGRFLPQDPEKRYDTLKWLVFQNTTMGPMLGQAHHFMVY
ATEKIDYAIERYDREVGRIYNILEKRLGESEYLAGDYSIADISAFPWVRTRKLHRRNLSE
YPNIDRWYQAIKDRPGVRAGIDTLSGSKQWEAKPGTEAWNNMFGKN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctatacttctggccgaccccaaacggatacaaagcagccataatgctggca
gagtcgggcttggattatcgtgtgattccggttgatataacggcaggcgagcagtttcat
ccggaatttctgaagatcaatccaaacaacaaagtgccggccatcgtggatcacgatggc
ccgcacaacaagccctatgcagtttttgaatccgcagtcgttctgatctatctcgcggaa
aagtccggtagattcctccctcaggatcctgaaaagcgctacgatacgctgaagtggctt
gtctttcagaatacgacgatgggtccaatgctggggcaagcgcaccacttcatggtgtat
gcgactgagaagattgactacgcgatcgaacgttatgatcgggaagttggtcgaatatac
aacattctcgagaagcgccttggcgaatctgaatacctcgccggcgactattctatcgct
gacatcagcgcattcccctgggttcgtacacgaaagttgcatcggcgcaacttgtcggag
taccccaacattgatcggtggtaccaagcgatcaaagaccgtccgggggttcgggcgggc
atagatacgttatccggcagcaaacaatgggaagcgaagccgggcaccgaggcctggaat
aacatgttcggaaagaactga

DBGET integrated database retrieval system