KEGG   Sphingopyxis macrogoltabida 203: LH19_10490Help
Entry
LH19_10490        CDS       T04627                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
smaz  Sphingopyxis macrogoltabida 203
Brite
Enzymes [BR:smaz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     LH19_10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2059329..2060021
Genome map
AA seq 230 aa AA seqDB search
MSTHPIFGRWPAEHPDRLQLFSAPTPNGVKVGIMLEETGLPYEPHRIDIMANESHDPAFL
ALNPNGKIPAIYDPDGPGGKPLALFESGAILIYLADKSGQFLPADAGGRYEAIQWVMWQM
GGVGPMFGQLGFFHKFAGKDYEDKRPRDRYATESARLLGVLDDRLANREWVMGDDYGIAD
ISLLGWVRNLIGFYGARDIVGFDRFGNVQRWLDAGLARPAVQRGLEVTAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcacccgatcttcggtcgctggcccgccgaacatcccgaccggctgcagctc
ttctcggcaccgacgccgaacggcgtcaaggtcggcatcatgctcgaggaaacgggcctg
ccctacgagccgcaccgcatcgacatcatggcgaacgaaagccacgatccggcctttctc
gcgctcaatcccaacggcaagattccggcgatctacgatcccgacgggcccggcggcaag
ccgctggcattgttcgaatcgggggcgatcctgatctatctcgccgacaagagcggacag
ttcctgccggccgatgcgggcgggcgttacgaagcgatccagtgggtgatgtggcaaatg
ggcggcgttggcccgatgttcggccagctcggcttcttccacaaattcgccggcaaggat
tatgaggacaagcgcccgcgcgatcgttacgcgaccgaatccgcgcggctgctcggcgtc
ctcgacgaccggttggcgaaccgtgaatgggtgatgggcgacgattacggcatcgccgat
atctcgctgctcggctgggtgcgcaacctgatcggcttctacggcgcgcgcgacatcgtc
gggttcgaccggttcgggaatgtccagcgctggctcgatgccgggctcgcccgacctgcg
gtacagcgcgggctggaggtaacggcggcctga

DBGET integrated database retrieval system