KEGG   Streptococcus mitis: smi_0615Help
Entry
smi_0615          CDS       T01173                                 

Gene name
ddL
Definition
(RefSeq) D-ala,D-ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smb  Streptococcus mitis
Pathway
smb00473  D-Alanine metabolism
smb00550  Peptidoglycan biosynthesis
smb01100  Metabolic pathways
smb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    smi_0615 (ddL)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    smi_0615 (ddL)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    smi_0615 (ddL)
Enzymes [BR:smb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     smi_0615 (ddL)
Peptidoglycan biosynthesis and degradation proteins [BR:smb01011]
 Precursor biosynthesis
  Amino acid ligase
   smi_0615 (ddL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 8799235
NCBI-ProteinID: YP_003445732
UniProt: D3H7M2
LinkDB All DBs
Position
557423..558466
Genome map
AA seq 347 aa AA seqDB search
MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEFSQTPGQ
EDRLMTNETIDWDKQVAPSAIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGCNILS
SSLAMDKITTKRVLESVGIAQVPYVAIVEGDDVTSKITEVEEKLNYPVFTKPSNMGSSVG
ISKSENQEELRQALKLAFQYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAFY
DYDAKYIDNKITMDIPAKISDDVVAVMRQNAETAFRAIGGLGLSRCDFFYTDKGEIFLNE
LNTMPGFTQWSMYPLLWDNMGISYPELIERLVELAKESFVKREAHLL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacgattattcttttatatggtggacggagtgcggaacgcgaagtctctgtc
ctttcagcggaaagtgtcatgcgtgcggtcaattacgaccgtttcacagttaagactttc
tttatcagccagtctggtgactttatcaaaacgcaggaatttagtcagactccaggtcaa
gaggaccgtctcatgaccaatgaaaccattgattgggataagcaggttgcaccaagtgct
atttacgaagaaggtgcagttgtctttccagttcttcacggtccgatgggagaagatggc
tctgttcaaggattcttggaagttttgaaaatgccgtatgtcggatgtaatatcttgtca
tctagccttgccatggacaaaatcactaccaagcgtgtgttagaatctgtcgggattgct
caagttccttatgtggctatcgttgaaggcgatgatgtgacttctaaaatcaccgaagtt
gaagaaaaattgaattatccagtcttcacaaaaccatcaaacatgggttcaagtgtcggt
atttcaaaatctgaaaaccaagaagaactccgtcaagctttgaaacttgccttccaatat
gacagccgtgtcttggtagagcaaggggtaaatgcccgtgaaatcgaggttggtctcttg
ggcaactacgatgtcaaaagcacgcttccaggggaagtagtcaaggatgttgccttttat
gactacgatgccaagtatattgacaacaagattaccatggacatcccagccaaaatcagt
gatgatgtagtggctgtcatgcgccaaaatgcagaaacagcctttcgtgccattggcggt
ctcggtctctctcgttgcgatttcttctatacagataagggagagattttcctaaacgag
ctgaataccatgccaggttttacccagtggtctatgtatccactgctttgggacaatatg
ggaatcagctacccagaactaatcgagcgtctggtggaacttgccaaggaaagttttgtc
aagcgcgaagcgcatttgctataa

DBGET integrated database retrieval system