KEGG   Sinorhizobium medicae: Smed_4038Help
Entry
Smed_4038         CDS       T00555                                 

Definition
(RefSeq) alpha amylase catalytic protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
smd00500  Starch and sucrose metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smed_4038
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Smed_4038
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Smed_4038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C GHL5 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 5318338
NCBI-ProteinID: YP_001312779
JGI_p1: Smed4038
UniProt: A6UGR6
LinkDB All DBs
Position
pSMED01:complement(499771..501405)
Genome map
AA seq 544 aa AA seqDB search
MNEAPWFTSSVIYGIDVRRFADGNGDGIGDFIGLRERVVYLSHLGIDCVWLSPFFRSPFA
DNGYDVSDYYSVDPALGTLDDFLNFLHAAGEHGIRVIIDLVANHTSSEHPWFQAARRDAR
CRFRDYYVWSASPPPVAPDNKTAFPGEESSVWTYDELAQAYYFHKFRHFQPDLNIANPAV
RDELLRVVDYWLTLGVDGFRVDAAPFVIGETGIEHADPRDPHGFLREMRELVEGRRRDGL
LLGEADLSPEKLRPYFGEGKLDLLFNFVLSASFAASLARQKADLIGQALSIMPEPPPHRG
WVNFLRNLDELNLDRLPEDIQQETFAAFAPDEEMRIYGRGIRRRLAPMLEGNQTRLELAF
SLLLSSPGVPLVLYGDEIGMGEDPSRPGREPVRVPMQWNAGANAGFSTAQRARLIQPIVT
DGPFAFKRINVEAQREDPRSLLNRVRAMILMRRSHKLFQRGRPIVLHTRDPALFALAYSD
GTELFVVLHNLTEAKRRAEVELPGAIDARLKDVFGEGEVELSGQHLTMGLGPFGYAWLHS
GRKD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggcgccgtggttcacaagctcggtcatctatggaatcgacgtgcgaaggttc
gctgacggaaacggcgacgggatcggcgacttcatcggactgagggagcgggtagtctat
ctgagccacctcggcatcgactgcgtctggctgtcgcccttcttcaggtcccccttcgcc
gacaatggttacgacgtcagcgactattactctgtcgatcctgcgctcgggacgctggac
gacttcctgaactttctgcacgctgccggcgaacacggtattcgcgtcatcatcgatctc
gtcgccaaccacacatcgagcgagcatccgtggtttcaggccgcacggcgggatgcgagg
tgccgcttccgcgattactatgtctggtccgccagcccgccgccggtcgctccggacaac
aagacggcatttcccggtgaggaaagcagcgtctggacgtatgacgagctcgcccaggcc
tattattttcacaagtttcgccacttccagccggacctgaacatcgccaatccggcggtg
cgcgacgaattgctccgcgtggtcgattactggctgacattgggcgtcgacggcttccgg
gttgatgccgcgcccttcgtcatcggcgagacgggcatagaacacgctgatcccagggat
cctcatggcttcctgcgggagatgcgtgagctggtcgaaggcagacgccgggatggtctt
ctgctcggcgaggcggacctctcgcctgaaaagctgcgcccctatttcggtgaagggaaa
ctcgatcttctgttcaacttcgttctgagcgcgtctttcgcggcaagcctcgcgcggcag
aaggccgatctcataggtcaggcgctttcgataatgccggagccgcctccccatcgaggc
tgggtcaatttccttcgcaatctcgacgagctcaacctcgaccgcctgccggaagacatc
cagcaggagacctttgccgccttcgctccggacgaggagatgcggatctacggacgcggc
atcaggcgtcggctcgcaccgatgctcgagggaaaccagacgagattggaactggcgttc
agcctgcttctttcttctccgggcgtgccccttgtcctctacggcgacgaaataggcatg
ggcgaagacccttcccgcccgggccgtgagcccgtccgcgtccccatgcagtggaacgct
ggcgccaatgccggcttttccacggcccagcgcgccaggctcatacagccaatcgtgacc
gacggacccttcgccttcaagcggatcaatgtcgaagcacagcgagaggacccccggtcg
ctcctcaaccgcgtccgggcgatgatcctgatgcggcgcagtcacaagctttttcaaagg
ggccggccgatcgtgctgcatacacgggatcccgcgctgtttgcgctcgcctattccgac
ggcaccgagctgttcgtcgtgctgcataatctaacggaggccaagcggcgggcggaagtc
gaactgcccggcgccatcgacgccaggctcaaggatgttttcggcgaaggcgaggtcgag
ctctccggccagcatctgacgatgggtcttggcccattcggctatgcctggctccattcg
ggaaggaaggactga

DBGET integrated database retrieval system