KEGG   Sinorhizobium medicae: Smed_4125Help
Entry
Smed_4125         CDS       T00555                                 

Definition
(RefSeq) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smd  Sinorhizobium medicae
Pathway
smd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smed_4125
Enzymes [BR:smd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Smed_4125
Transporters [BR:smd02000]
 Other Transporters
  Pores ion channels [TC:1]
   Smed_4125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 5319318
NCBI-ProteinID: YP_001312864
JGI_p1: Smed4125
UniProt: A6UH01
LinkDB All DBs
Position
pSMED01:complement(593942..594553)
Genome map
AA seq 203 aa AA seqDB search
MKLYHHPLSGHAHRVRLFLSLLGLEHELVHVDLASKEHKQEPFLKLNPFGQLPVLDDGGT
IVPDSNAILVYLAKKAGCTDWLPEDAGGAAAVQRWLSVAAGQIAHGPAQARLITLFQAPY
RPEEVIPRSHAILKLIESELGGRSWIAAERPTIADVALYSYVARAPEGDVDLHPYPEIRS
WLARIEALPGFVEFQKTPAGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatcatcacccactttccggccatgcgcaccgcgtccggctgttcctctcg
cttctggggctcgagcacgaactcgtgcacgtcgatctcgccagcaaagaacacaagcag
gagccttttctgaagctcaatcccttcggtcagctgccggtgcttgacgatggcggaacg
atcgtcccggattccaacgccattctggtttatctcgccaaaaaggccggctgcacggac
tggctgccggaggacgcaggaggggcagccgcggttcagcgatggctttcggtggctgct
ggccagatcgcccacggtccggcccaggcgcgtctgatcacccttttccaggctccttac
cggccggaagaggtcatcccccgctcgcatgcgatcctaaagctgatcgagtcggagctc
ggcggcagaagctggattgccgccgagcggccaacgatcgccgatgtcgcgctctacagc
tatgtggcgcgcgcaccggaaggggatgtggaccttcacccctatccggaaatccgctcc
tggctcgcccgcatcgaggccttgccgggcttcgtcgagttccaaaagaccccggcaggt
ctcgcggcttag

DBGET integrated database retrieval system