KEGG   Sinorhizobium meliloti 1021: SM_b20005Help
Entry
SM_b20005         CDS       T00058                                 

Gene name
gst15
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SM_b20005 (gst15)
Enzymes [BR:sme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SM_b20005 (gst15)
Transporters [BR:sme02000]
 Other Transporters
  Pores ion channels [TC:1]
   SM_b20005 (gst15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 1236421
NCBI-ProteinID: NP_436548
RhizoBase: SM_b20005
UniProt: Q92XF3
LinkDB All DBs
Position
pSymB:8289..8900
Genome map
AA seq 203 aa AA seqDB search
MKLYHHPLSGHAHRARLFLSLLGIEHELVVVDFARREHKQADFLKLNSFGQVPVLDDAGT
IISDSNAILVYLAKKTGRPDWLPEDAVGAAAVQRWLSVAAGQIAHGPAQARLINVFKAPY
RPEEVIPRSHAILALIEQELEGRGWIAADRPTIADVALYSYVARAPEGDVDLQPYPEIRA
WLARIEALPGFVEFEKTPVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatcaccatcccctctccggccacgcgcaccgcgcccgcctgttcctctca
ctgctcggtatcgagcatgagctggtggtcgtcgatttcgccaggagagagcacaagcaa
gcggatttcctgaagctcaattccttcggtcaggttccggtgctcgacgacgccggcacg
atcatctcggattccaacgccattctcgtctatctggcgaagaagaccggccgcccggac
tggctgccggaagacgccgtgggcgcggctgccgttcagcgctggctttcggtggctgcc
ggccagatcgcccatggtccggcccaggcgcggctcatcaacgtgttcaaggcgccctac
cgaccggaagaggtgatcccccgttcgcatgcgatcctggcgctgatcgagcaggagctg
gaaggcagaggctggattgccgcagaccggccgacgatcgccgatgtcgcgctctacagc
tacgtagcgcgcgcccccgaaggcgacgtcgatctccagccctatccggagatccgcgcc
tggctcgcccgcatcgaggcattgccgggattcgtcgagttcgaaaagacgccggtgggg
ctggcggcttag

DBGET integrated database retrieval system