KEGG   Sinorhizobium meliloti 1021: SMc02597Help
Entry
SMc02597          CDS       T00058                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase Cu-Zn precursor (bacteriocuprein) transmembrane protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMc02597 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 1232741
NCBI-ProteinID: NP_385203
RhizoBase: SMc02597
UniProt: Q926D4
LinkDB All DBs
Position
1197390..1197908
Genome map
AA seq 172 aa AA seqDB search
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaacgatgattgcgatcgcctgtgcggcaggaatggcgggtgccgcttcggca
caacagtcctcgcagacggcgacggccgagttcgtgggcaaggacggcacggacatcggc
cgggccactttgacggcaggcggcaagggcgtgctgatcgagatggagataagcggcctg
ccgaaggatacctgggtggcttttcacgctcacgaaatggggcgctgcgatcccaaggac
gggttcgagtcggcgggaaagcattttgccggcgaagatgagaatgccgagcacggcttc
ctcgcttccaatggcccgcatgccggcgacatgccgaaccagtatgtcggtgccgatgga
accttgcgcgcccaggtcttcaacagcttcgtgtccctcgacgacagggctaccgccctt
cgcggccgggccctggtgatccatgtgcattcggacgacaatcgcagccagccctccggc
gatgccggcgaccggctggcctgcgcggtggtgaagtag

DBGET integrated database retrieval system