KEGG   Sinorhizobium meliloti 2011: SM2011_b21186Help
Entry
SM2011_b21186     CDS       T02497                                 

Gene name
gabT
Definition
(GenBank) Putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00250  Alanine, aspartate and glutamate metabolism
smel00410  beta-Alanine metabolism
smel00640  Propanoate metabolism
smel00650  Butanoate metabolism
smel01100  Metabolic pathways
smel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SM2011_b21186 (gabT)
   00650 Butanoate metabolism
    SM2011_b21186 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SM2011_b21186 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM2011_b21186 (gabT)
Enzymes [BR:smel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SM2011_b21186 (gabT)
Amino acid related enzymes [BR:smel01007]
 Aminotransferase (transaminase)
  Class III
   SM2011_b21186 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGG71862
LinkDB All DBs
Position
pSymB:complement(935356..936624)
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQVYADRAENAEIWDKEGNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNAIVPGDFAKKTIFVTTGAEAVENAVKIAR
AATGRQAVVAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVTVEQS
LSALKKLFAADVDPARVAAIIIEPVQGEGGFYPVPTAFMKALREVCDQHGILLIADEVQT
GFARTGKLFAMEHHGVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPL
GIAAAHAVLDVIAEENLCERANQLGNRLKQRLAAIREKAPEIVDIRGPGFMNAVEFNDVR
TNLPSAEFANKVRLLALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDTIEASILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcctcacagatcgcaagaacgcagccatctcccgcggtgtcggaatgaccacg
caggtctatgccgatcgcgcggaaaacgccgagatctgggacaaggaaggcaaccgctac
atcgactttgccgccggcatcgccgtggtcaatacaggccaccgccacccgaaggtgatc
gccgccgtcaaggcgcagctcgaccgcttcacccatacatgccaccaggtggtgccctac
gagaactacgtgcatctggcggagcgcctgaacgcgatcgtgcccggcgacttcgcgaag
aagaccatcttcgtcacgaccggcgcggaagccgtcgagaacgcagtgaagatcgcgcgg
gccgcgacgggccgccaggcggtcgtcgccttcggcggcggtttccatggccgcaccttc
atgggcatggcgctgacgggcaaggtcgttccgtacaaggtcggtttcggcgcgatgccg
gcagatgtcttccacgcccccttcccgatcgagcttcacggcgtgactgtcgagcagtcg
ctttcggcgctgaagaagctgttcgcggccgatgtcgatccggcccgcgtcgcagcgatc
atcatcgagccggttcagggagaaggcggcttctatccggtcccgaccgccttcatgaag
gcgcttcgcgaggtctgcgaccagcatggcatcctgctgatcgccgacgaggtgcagacc
ggatttgcccgcaccggcaagctcttcgccatggaacatcacggtgtcgcgccggacctg
acgacgatggcgaagagcctcgccggcggctttccgcttgccgccgtcaccggccgcgcc
gaaatcatggatgcgcccgggccgggcggcctcggcggcacctatggcggtaatccgctc
ggcatcgccgccgcgcatgccgtcctcgacgtgattgccgaggagaacctgtgcgagcgg
gcgaaccagctcggcaaccggctgaaacagcgccttgcggcgatccgcgagaaagcaccg
gaaatcgtcgacatccgcggacccggcttcatgaacgccgtcgaattcaacgacgtgagg
acgaacctgccgagcgccgaattcgcaaacaaggtccgcctccttgccctcgaaaagggg
ctcatcctgctgacctgcggcgtccatggcaacgtcatccgtttcctggcgccgatcacg
atccaggacgaggtcttcgcagaagccctcgacactatcgaggcatcgatcctcgaagca
cgcggttga

DBGET integrated database retrieval system