KEGG   Sinorhizobium meliloti 2011: SM2011_c00036Help
Entry
SM2011_c00036     CDS       T02497                                 

Gene name
gst1
Definition
(GenBank) Putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SM2011_c00036 (gst1)
Enzymes [BR:smel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SM2011_c00036 (gst1)
Transporters [BR:smel02000]
 Other Transporters
  Pores ion channels [TC:1]
   SM2011_c00036 (gst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C Tom37 PEPCK_N GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGG73535
LinkDB All DBs
Position
1050796..1051416
Genome map
AA seq 206 aa AA seqDB search
MLKLFYTPGTCSLASHIALEEAGAGYEVHRVDFSKAEQTKPDYLTINPKGRVPALVTDRG
ILTETPAILAYIAQSFPKARLAPLDDPFEFARLQSFLSYLCSTVHVAHAHARRAARWADD
PAAQEAMKAKVPQNMADCFALIERTMFVGPFVRGDAYSVADPYLFTIAGWLESDGVDPAR
FPRILDHRNRMAERPAVAKVLAEVQS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgttttatacgcccggaacctgctcgcttgcctcgcacatcgcgttagag
gaagccggtgccggctatgaagtgcatcgggtcgatttttccaaagccgagcagaccaag
ccggactacctcaccatcaaccccaaggggcgggtgcccgccctcgtgaccgaccgtggt
atcctgaccgagacgccggccattctcgcctatatcgcccagagcttcccgaaggcgcgg
cttgcgccgcttgacgatcctttcgagttcgctcggctgcagtcgttcctgagctatctc
tgctcgacagtccacgtcgcccatgcccatgcccgtcgagccgcgcggtgggcagacgac
ccggcagcgcaggaggcgatgaaggccaaggtgccgcagaatatggccgactgcttcgcg
ctgatcgagcgcacgatgttcgtcggcccctttgtcaggggcgacgcctactcggtcgcc
gatccctacctcttcaccatcgccggctggctcgagtcggacggtgtcgatccggcccgg
tttccgcgaatcctcgaccatcgcaacaggatggccgagcgtccggccgtcgccaaggtt
ctggctgaagtgcagtcgtag

DBGET integrated database retrieval system