KEGG   Sinorhizobium meliloti RMO17: DU99_16815Help
Entry
DU99_16815        CDS       T03395                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00020  Citrate cycle (TCA cycle)
smer00310  Lysine degradation
smer00380  Tryptophan metabolism
smer01100  Metabolic pathways
smer01110  Biosynthesis of secondary metabolites
smer01120  Microbial metabolism in diverse environments
smer01130  Biosynthesis of antibiotics
smer01200  Carbon metabolism
Module
smer_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smer_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smer00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DU99_16815 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    DU99_16815 (sucA)
   00380 Tryptophan metabolism
    DU99_16815 (sucA)
Enzymes [BR:smer01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     DU99_16815 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIM00991
UniProt: A0A220N0X6
LinkDB All DBs
Position
complement(3393413..3396409)
Genome map
AA seq 998 aa AA seqDB search
MTRQEANEQFQLTSFLDGANAAYIEQLHARYEADPSSVSAEWQSFFKALADRPEDVVRAA
KGASWKKQNWPIPANGELVSALDGDWGTVEKVIEKKVKAKAEEAAAVAGVALSEAEVHQS
TRDSVRAIMMIRAYRMRGHLHAKLDPLGLADPVEDYDELSPKTYGFEEKDYDRKIFIDNV
LGLEYATVREMVEILERTYCSTIGVEFMHMSNPEEKGWIQERIEGPDKGVEFTPEGKKAI
LQKLIEAEGFEQFIDVKYKGTKRFGVDGGESLIPALEQIIKRGGQLGLKEIVLGMAHRGR
LNVLSQVMAKPHRAIFHEFKGGSYTPDDVEGSGDVKYHLGASSDREFDGNKVHLSLTANP
SHLEIVNPVVMGKARAKQDQMATVFEGDIIPLRERVKVMPLILHGDAAFAGQGVVAEILG
LSGLRGHRVGGTVHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVY
AAKVATEFRMKFHKPVVIDMFCYRRFGHNEGDEPAFTQPKMYKAIRAHKTVVQLYSDRLI
AEGLISEGEVEKMKADWRAHLEQEFEAGQSYKPNKADWLDGAWSGLRTADNQDEQRRGRT
SVPMKQLKEVGRKLSEIPAGFSAHRTIQRFMENRANMIQTGEGIDWAMAEALAFGTLVTE
GTKIRLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGF
EYGYSLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGP
EHSSARLERFLQLCAEDNMQVANVTTPANYFHILRRQVKRDFRKPLILMTPKSLLRHKRA
VSSLSEMAGESSFHRLLWDDAEVIKDGPIKLQKDSKIRRVVMCSGKVYYDLLEEREKRGI
DDIYLLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDA
KYQRVRYTGRPAAASPATGLMSKHLAQLAAFLEDALGG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcaagaggccaacgagcaattccagctcacatcctttctggacggcgccaat
gccgcctatatcgagcagctccatgcgcgctacgaagcggacccctcatccgtttcggcc
gagtggcagtccttcttcaaggcgcttgccgaccggcccgaagatgtggtgagggcggcc
aagggcgcctcctggaagaagcagaactggccgattcccgccaatggcgaactcgtctcg
gccctcgacggcgactggggcacggtcgaaaaggtcatcgaaaagaaggtgaaggcgaag
gcagaggaagccgcagccgttgccggcgtggcgctcagcgaggccgaggtgcatcagtcg
acgcgcgattccgtccgcgccatcatgatgatccgcgcctatcgcatgcgcggccacctg
cacgccaagctcgacccgctcggccttgccgatccggtcgaggattacgacgaactctcc
ccgaagacctacggcttcgaagagaaggactacgaccgcaagatcttcatagacaacgtg
ctcggcctcgaatatgcgaccgtgcgcgagatggtcgagatcctcgaacggacctattgt
tcgacgatcggcgtcgaattcatgcatatgtccaacccggaagagaagggctggatacag
gaacgcatcgaagggccggacaagggcgtcgaattcacccccgagggcaagaaggcgatc
ctgcagaagctcatcgaggcggaaggcttcgagcagttcatcgacgtcaagtacaagggc
accaagcgcttcggcgtcgacggcggcgaatcgctgatcccggcgctcgagcagatcatc
aagcgcggcggccagctcggcctcaaggagatcgtgctgggcatggcgcatcgcggccgc
ctcaacgttctctcgcaggtgatggccaagccgcaccgcgccatcttccacgagttcaag
ggcggctcctacacgcccgatgacgtggaaggctccggcgacgtcaagtatcacctgggc
gcttcctcggaccgcgagttcgacggcaacaaggtccacctgtcgctgacggcaaacccg
tcgcatctcgagatcgtcaatccggtcgtcatgggcaaggcgcgcgccaagcaggaccag
atggcgaccgtattcgaaggcgacatcattccgctgcgcgaacgcgtcaaggtcatgccg
ttgatcctgcacggcgacgcggcatttgccggccagggcgtggtcgccgaaattctcggc
ctctccggcctgcgcgggcatcgtgtcggcggcacggtgcacttcatcatcaacaaccag
atcggtttcaccacgaacccggccttctcgcgttcctcgccctatccgtcggacgtggcg
aagatgatcgaggcgccgatcttccacgtgaacggtgacgatccggaagcggtcgtctat
gcggccaaggtcgcgaccgaattccggatgaagttccacaagccggtggtcatcgacatg
ttctgctaccgccgcttcggtcacaacgagggcgacgagccggcgttcacgcagccgaag
atgtacaaggcgatccgtgcgcacaagaccgtcgtccagctctattcggaccggctgatc
gccgagggcctgatcagcgaaggcgaagtcgagaagatgaaggccgattggcgcgcccat
ctcgaacaggaattcgaggcgggtcagtcctacaagccgaacaaggccgactggctcgac
ggcgcctggtcgggcctgcgcacggccgacaaccaggatgagcagcgccgcgggcggacc
tcggtgccgatgaagcagttgaaggaggtcggccgcaagttgtccgaaattccggccggc
ttcagcgcgcaccgcaccatccagcgcttcatggaaaaccgcgccaatatgatccagacc
ggcgagggcatcgactgggcgatggcggaagcgctcgccttcggtacgctcgtcaccgag
ggcaccaagatccgcctctccggtcaggattgcgagcgcggcaccttctcgcagcgccat
tcggttctctacgatcaggagaccgaagagcgatacattccgctcgccaacctgtcgccg
acccaggcacgctacgaggtcatcaattcgatgctctcggaagaggcggtgctcggcttc
gaatacggctattcgctcgcccgcccgaacgccctgacgctctgggaagcccagttcggc
gacttcgccaacggcgcgcaggtggtcttcgaccagttcatctcgtcgggcgagcgcaag
tggctgcgcatgtcgggcctcgtctgcctgctgccgcacggctacgagggccaggggccg
gagcattcctccgcccggctggaacgcttcctgcagctttgcgcggaagacaacatgcag
gtcgccaacgtcacgaccccggcgaactatttccacatcctgcgccgtcaggtgaagcgc
gatttccgcaagccgctgatcctgatgacgccgaagtcgctgctgcgtcacaagcgggcg
gtctcgagcctgtcggaaatggccggcgagagctccttccatcgtctcctctgggacgat
gccgaggttatcaaggacggtccgatcaagctgcagaaggattcgaagatccgtcgcgtc
gtcatgtgctcgggcaaggtctattacgaccttctggaggagcgcgagaagcgcggcatc
gacgacatctacctgctgcgcgttgaacagctctatccgttcccggccaaggcgctcatc
aacgagctcagccgcttccgcaacgcggagatggtctggtgccaggaagagccgaagaac
atgggcgcctggtcgttcatcgatccctatctggagtgggttcttgcccatatcgatgcc
aagtaccagcgggtgcgctataccggccgtccggccgccgcttccccggcgacgggcctg
atgtccaagcatctggcacagcttgccgccttcctcgaggatgcgctggggggctga

DBGET integrated database retrieval system