KEGG   Sinorhizobium meliloti RMO17: DU99_19515Help
Entry
DU99_19515        CDS       T03395                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smer00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DU99_19515
Enzymes [BR:smer01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DU99_19515
DNA repair and recombination proteins [BR:smer03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DU99_19515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AIM01492
LinkDB All DBs
Position
pSymA:303511..306147
Genome map
AA seq 878 aa AA seqDB search
MADNLSKYRAKRDFKKTREPSGEAQVKQSNRRRFVIQKHDATRLHYDLRLELDGVFKSWA
LTKGPSLDPSDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGRKSPEE
ALKKGDFKFTLHGKRLHGSFVLVRMRNDRDGGKRTNWLLIKHRDDYSVDENGAAILEENA
TSIASARSMEQIAEGTGRKPRPFMMANADVEADAVWDSKHGLAAEERKKGSRRDLATSTA
ADLPDFIEPQLCETLARPPASDDWLHEIKFDGYRIQMRVADGKVTLKTRKGLDWTAKYPE
IADAASELPDCIIDGEICALDDNGAPDFAALQAALSEGKTGNLVYFAFDLLFDGGEDLRS
MRLVERKKRLEDFLAAGSDDPRIRYVDHFESGGDAVLRSACKLSLEGIVSKQMDAPYESG
RTDTWAKSKCRAGHEVVIGGYARTNGKFRSLLVGVHRGDHFVYVGRVGTGFGAAKVERFF
PKLKALEASKSPFTGIGAPKKEKEVTWLKPELVAEIEFAGWTTDGLVRQAAFKGLREDEP
AKEVQAEKPSPPAKTDTPEPGPSAKTRPVRRKGAKAEVIGVLISSPDKPLWPDAGDGEPV
TKEDLARYHEAVGTWLIDHIKGRPCSIIRAPDGIGGEQFFLRHAMQGTSNLLELVKVFGD
KKPYLQIDRIEGLAAIAQIGGIELHPWNCEPGKPEVPGRLVFDLDPGPDVPFATVVAAAR
EMRDRLDELGLVSFCKTTGGKGLHVVTPIAVNKRKPLSWAEAKGFAHEVCEQMARDNPDL
YLIKMSKSLRGGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLNWTQVKSDFDPKRFT
VRTVPALLAKTTAWQDYCDGERPLEQAIKRLGKSRRAA
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatctttcgaaataccgtgccaagcgcgatttcaagaagaccagagaacca
agcggcgaggctcaggtcaagcagtcgaaccgccggcggttcgtgatccagaagcacgac
gccacccggcttcactatgatctgcggcttgaactggacggggtgttcaagagctgggcg
ttgaccaagggcccatcgctcgatcctagtgacaagcgactggccgtcgaagtcgaagat
cacccgctcgactatggcgacttcgaaggcacgattccaaagggccagtatggcggcggc
acggtcatgctatgggaccgcggctattgggagccagaaggtaggaagtcacctgaagag
gccctgaagaagggcgacttcaagttcacgcttcatggcaagcggctgcatggcagcttc
gtcctggtgcggatgcgcaacgatcgcgatggcggcaagcggaccaactggctgctcatc
aaacatcgtgacgattactccgttgacgagaacggcgcggcaatcctggaggagaacgcg
acttccatcgcctccgcccgcagcatggagcagatcgccgagggcacgggccgcaagccg
cgaccgttcatgatggcgaacgcggatgtcgaggcagatgccgtctgggacagcaagcat
ggcttggcagcggaagagcgcaagaaggggtctcgcagggatctcgcgacctccacggca
gccgacctgccggattttatcgagccgcagctctgcgagacgcttgcgcggccgccggcc
agcgacgactggctgcatgagatcaagttcgacggttatcggatccagatgcgggttgcc
gacggtaaggtgacgctgaagacgcgcaagggtctcgactggaccgcgaaatatccagag
atcgccgatgctgcgtccgaattgcccgattgcatcattgatggcgaaatctgcgccctc
gacgacaatggcgcgcccgatttcgcagcactccaggccgcgctctcggaaggcaagacc
ggcaaccttgtctacttcgccttcgacctgctgtttgatggcggcgaggacttgcggtcg
atgcgattggtcgagcggaagaagcggctcgaagacttcctcgcggccgggagcgacgat
ccgcgtatccgctacgtcgatcacttcgaatccggcggtgacgcggtgctccgctccgcc
tgcaagctgtcgctcgaaggtatcgtctccaagcagatggatgcgccctacgaatcgggc
cgcaccgacacctgggcgaagtcgaaatgccgggctggtcatgaggtggtgatcggtggc
tatgctaggaccaacggcaagtttcgatctctcctggtcggcgttcaccgcggcgatcac
ttcgtctatgtcggccgggtcggcacgggcttcggcgccgcgaaggtcgagcggttcttt
cccaagctgaaggcgttggaagcatcgaagtcacccttcaccggcatcggtgcgccgaaa
aaggagaaggaagtcacctggctgaaaccggagctcgttgccgagatcgagttcgccggc
tggacgaccgacggcctagttcgtcaggcagccttcaaaggcctgcgcgaggacgagccg
gcgaaagaggtccaggccgagaagccgtcaccgcccgccaagaccgacacgcccgagcct
gggccgtccgccaagaccagaccggtgcggcgcaagggcgccaaggccgaggtcataggc
gtcctcatctccagtcccgacaagccactctggccggacgccggcgatggcgagcccgtg
accaaggaagatctcgcccgctaccatgaagccgtcggaacctggctcatcgatcacatc
aagggccggccctgctcgatcattcgagcacccgacggcattggcggcgagcagttcttc
ctgcgccatgcgatgcaaggcacctccaatctgctcgaactggtgaaagtcttcggggac
aagaagccctaccttcagatcgatcggatcgaagggctcgcggcgatcgcccagatcggc
ggaatcgaactacatccctggaactgcgaacccggcaagccggaagtgcccggccgtctg
gtgttcgatctcgatcctggtcccgacgtgccgtttgcgacagtggtcgcggccgcgcgg
gaaatgcgtgaccggctcgacgagctcggcctcgtcagtttctgcaagacgaccggcggg
aagggattgcatgtcgtcacgccaatcgctgtgaataagcgcaagcctctgtcatgggcc
gaggctaagggattcgcgcatgaagtttgcgagcaaatggcgcgcgataatcccgatctt
tatctcatcaagatgagcaagagcctcaggggcggaaggatcttcctcgattatctccgc
aacgaccgcatggcgaccgccgtggcgccactgtcgccgcgcgcacggcccggcgccaca
gtctcgatgccgctcaactggacgcaggtgaagtccgatttcgacccgaagcggtttacc
gtccgcaccgtgccggcgctgcttgcgaaaaccactgcctggcaagactattgtgatggc
gagcggccgctcgaacaggcgatcaagcgcctcggaaaatcaagacgggctgcgtga

DBGET integrated database retrieval system