KEGG   Sinorhizobium meliloti RMO17: DU99_24400Help
Entry
DU99_24400        CDS       T03395                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00910  Nitrogen metabolism
smer02010  ABC transporters
Module
smer_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:smer00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    DU99_24400
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    DU99_24400
Transporters [BR:smer02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    DU99_24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: AIM02349
LinkDB All DBs
Position
pSymA:1255009..1255902
Genome map
AA seq 297 aa AA seqDB search
MSVTNLKLKPQATPQTSAQVIALGQTASRGIDGRLSRFVTQTVTNLLPLLVTLTFFTLAW
QLICSSPESSLPAPSRVLEESWELIAHPFYIGQGVDQGLFWHVFASLQRVALGYAMAAAV
GVALGTLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGTPSAIFVIFITAIWPI
IINTAVGIRNIPQDYQNVAKVLRLNGFEYFGKIMLPAAAPYIFTGLRIGIGLSWLAIVAA
EMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDRLIALVGRAVTRGTANA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccaatctcaagctcaaaccccaggcgactccgcagacctccgcccaggtc
atcgctctcgggcagacggcgagccgcggcatcgatggccgtttgtcgcgctttgtcacc
cagacggtcaccaacctcttgccgctgctcgtcacactgacgttcttcacccttgcctgg
cagctcatctgctcgtcgcctgaatcgagccttccggccccgtcgcgtgtcctcgaggaa
agctgggaactgatcgcacatcccttctacatcggtcagggcgtcgatcagggtctgttc
tggcacgtgttcgccagcctgcagcgcgtcgcgctgggctacgcgatggctgcggcggtc
ggcgtcgcgcttgggacgctcgtcggccagagcgcgctcgcgatgcgcggcctcgatccg
atcttccaggtgcttcgcaccgtgccgccgctcgcctggctgccgctttcactcgccgcc
ttccaggatggcaccccttcggcaatcttcgtcatcttcatcacggcgatctggccgatc
atcatcaacaccgcggtcggcatccgcaacattccgcaggattaccaaaacgtcgccaag
gtgctgcggctgaacggcttcgaatatttcggcaagatcatgctgccggccgctgccccc
tacatcttcaccggtcttaggatcggcatcggtctctcctggctggcgatcgtggcggcc
gagatgctgatcggcggcgtcggcatcggcttcttcatctgggatgcgtggaactcgtcg
ctgatcagcgacatcatcgtggcgctcatctatgtcggcattgtcggctttctcctcgac
cgcctcatcgcactcgtcggccgcgccgtcacccgcggcactgcaaacgcttag

DBGET integrated database retrieval system