KEGG   Sinorhizobium meliloti RMO17: DU99_32380Help
Entry
DU99_32380        CDS       T03395                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00630  Glyoxylate and dicarboxylate metabolism
smer00710  Carbon fixation in photosynthetic organisms
smer01100  Metabolic pathways
smer01120  Microbial metabolism in diverse environments
smer01200  Carbon metabolism
Module
smer_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smer00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DU99_32380
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DU99_32380
Enzymes [BR:smer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DU99_32380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AIM03858
UniProt: A0A222LJI0
LinkDB All DBs
Position
pSymB:1485371..1485760
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggatgcttctcgttcctgcccgacctgaccgacgagcagatcacg
gcgcaggtggaatattgccttggaaagggttgggctatcggcgtcgagtataccgacgac
cctcatcctagaaacacctattgggaaatgtggggcaacccgatgttcgacctcaaggac
gccaaaggcgtgatgatggaggtggaggattgccgcaaggcccatccgcaggactatatc
cgcctcaacgccttcgattccagccgcggcctggagacggtgacgatgtcgttcatagtc
aaccgtcccgaaaacgagccgagcctcaggatgacccggacggagagcaacggccgcagc
cagcattatatgtgggaaacgcagcgatag

DBGET integrated database retrieval system