KEGG   Sinorhizobium meliloti RMO17: DU99_32380Help
Entry
DU99_32380        CDS       T03395                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smer00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DU99_32380
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DU99_32380
Enzymes [BR:smer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DU99_32380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pSymB:1485371..1485760
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggatgcttctcgttcctgcccgacctgaccgacgagcagatcacg
gcgcaggtggaatattgccttggaaagggttgggctatcggcgtcgagtataccgacgac
cctcatcctagaaacacctattgggaaatgtggggcaacccgatgttcgacctcaaggac
gccaaaggcgtgatgatggaggtggaggattgccgcaaggcccatccgcaggactatatc
cgcctcaacgccttcgattccagccgcggcctggagacggtgacgatgtcgttcatagtc
aaccgtcccgaaaacgagccgagcctcaggatgacccggacggagagcaacggccgcagc
cagcattatatgtgggaaacgcagcgatag

DBGET integrated database retrieval system