KEGG   Streptobacillus moniliformis: Smon_1216Help
Entry
Smon_1216         CDS       T01125                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00010  Glycolysis / Gluconeogenesis
smf00020  Citrate cycle (TCA cycle)
smf00620  Pyruvate metabolism
smf01100  Metabolic pathways
smf01110  Biosynthesis of secondary metabolites
smf01120  Microbial metabolism in diverse environments
smf01130  Biosynthesis of antibiotics
smf01200  Carbon metabolism
Module
smf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smon_1216
   00020 Citrate cycle (TCA cycle)
    Smon_1216
   00620 Pyruvate metabolism
    Smon_1216
Enzymes [BR:smf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Smon_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: ACZ01671
UniProt: D1AVB1
LinkDB All DBs
Position
complement(1332221..1333288)
Genome map
AA seq 355 aa AA seqDB search
MERKIFRATPAARKLASQLSLDLSAIPGSGAFGRIHKEDVASYKAEASIKISPVARRIAE
DNSINWQELKGSGIRGKIMKSDILALLSPDKKESYVAPSKEKEYINQEKTNVEQQLDDKK
DKYGEIEVIPMTAMRKVIAKRMVESYLTAPTFTLNYDVDMSEALALRKKLLEPILAQTGK
KVTVTDIISLAVIKTLMKHKYLNSSLTEDGQKIIAHNYVNLAMAVGFDGGLLTPVVYNAE
KMSLSELVVALKDVTSRALEMKLAPSELQGSTFTISNLGMFGVSSFGPIINQPNSAILGV
SATIEKPVVINGEIKVRPIMSLGLTIDHRVVDGLAGAKFMKDLKELLENPITMLI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaaatatttagagctacacctgctgcaagaaaattagcatcacaacttagt
ttagatttatcagcaatacctggtagtggtgcttttggaagaatacataaagaagatgtg
gcttcatataaggcagaggcaagtattaaaatatctcctgtagcaagaagaattgcagaa
gataatagtataaactggcaagagcttaaaggaagtggaataagaggtaagataatgaaa
tcagatattttagctctattatcacctgataagaaagaaagctatgttgcacctagcaag
gaaaaagaatatataaatcaagaaaaaacaaatgtagaacaacaattagatgataagaaa
gataaatatggggaaatagaagtaatacctatgacagcaatgagaaaagttattgcaaaa
cgtatggttgaaagttatctaacagcacctacatttacattaaattatgatgtagatatg
agtgaagcacttgcattaagaaagaaattgttagaaccaatcttagcacaaactggtaag
aaagtaactgttactgatattatctcacttgcagtaattaaaacattaatgaaacataaa
tacttaaattcttcattaactgaagatggacaaaagatcattgcacataattatgtaaac
ttagcaatggcagtaggatttgatggaggattattaacaccagttgtatataatgcagaa
aaaatgagtttatcagaattagttgttgcattgaaagatgtaacatctcgtgctcttgaa
atgaaacttgcaccaagtgaattacaaggttcaacatttactataagtaacttaggaatg
tttggagtatcatcatttggtccaataataaatcaacctaattcagcaatattaggggta
agtgctacaatagaaaaaccagtagtaattaatggtgaaattaaagttagacctataatg
tctttaggattaactatagatcatagagttgtagatggtcttgctggagctaaatttatg
aaagatttaaaagaattattggaaaatccaattacaatgttaatataa

DBGET integrated database retrieval system