KEGG   Sinorhizobium meliloti Rm41: BN406_01151Help
Entry
BN406_01151       CDS       T02332                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BN406_01151 (hisI)
Enzymes [BR:smi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BN406_01151 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1172531..1172983)
Genome map
AA seq 150 aa AA seqDB search
MTLTFASPPQDKAELESGPAFTPRFDEKGLITAVVTDARDGELLMVAHMNAEALSLTLET
GFAHYYSRSRDRLWKKGESSGNLQTVREIRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVGVADGEAKVAITDDHRHFDPAQIYAGN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcacttttgcatcccccccgcaggacaaggccgaactggaaagcggcccggcc
ttcaccccgcgtttcgacgagaagggtctgatcacggccgtcgtgaccgatgcccgcgat
ggcgaattgctgatggtcgcgcatatgaacgccgaagcgctgtccctcacgctcgagacc
ggattcgcgcattactacagccgctcacgcgaccgcctctggaagaagggcgaaagctcg
ggcaatttgcagaccgtccgggaaatacgaaccgattgcgaccaggacgccgtctggttg
aaagtctcggtggccggccacgatgccacctgccataccgggcgccgctcgtgcttctat
cggacggtcggcgtcgccgatggcgaagcaaaagtggcgatcaccgacgaccacaggcat
ttcgatccggcgcagatctacgccggcaactga

DBGET integrated database retrieval system