KEGG   Sinorhizobium meliloti AK83: Sinme_4165Help
Entry
Sinme_4165        CDS       T01521                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sinme_4165
Enzymes [BR:smk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sinme_4165
Transporters [BR:smk02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sinme_4165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AEG55858
JGI: Sinme_4165
LinkDB All DBs
Position
2:complement(490471..491082)
Genome map
AA seq 203 aa AA seqDB search
MKLYHHPLSGHAHRARLFLSLLGIEHELVVVDFARREHKQADFLKLNSFGQVPVLDDAGT
IISDSNAILVYLAKKTGRTDWLPEDAAGAAAVQRWLSVAAGQIAHGPAQARLINVFKAPY
RPEEVIPRSHAILALIEQELEGRGWIAADRPTIADVALYSYVARAPEGDVDLQPYPEIRA
WLARTEALPGFVEFEKTPVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctatcaccatcccctctccggccacgcgcaccgcgcccgcctgttcctctcg
ctgctcggtatcgagcatgagctggtggtcgtcgatttcgccaggagagagcacaagcaa
gcggatttcctgaagctcaattccttcggtcaggttccggtgctcgacgacgccggcacg
atcatctcggattccaacgccattctcgtctatctggcaaagaagaccggccgcacggac
tggctgccggaagacgccgccggggcggctgccgttcagcgctggctttcggtggctgcc
ggccagatcgcccatggtccggcccaggcgcggctcatcaacgtgttcaaggcaccctac
cgaccggaagaggtgatcccccgttcgcatgcgatcctggcgctgatcgagcaggagctg
gaaggcagaggctggattgccgcagaccggccgacgatcgccgatgtcgcgctctacagc
tacgtagcgcgcgcccccgaaggcgacgtcgatctccagccctatccggagatccgcgcc
tggctcgcccgcaccgaggcattgccgggattcgtcgagtttgaaaagacgccggtgggg
ctggcggcttag

DBGET integrated database retrieval system