KEGG   Stenotrophomonas maltophilia K279a: Smlt3220Help
Entry
Smlt3220          CDS       T00718                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smlt3220
Enzymes [BR:sml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Smlt3220
Transporters [BR:sml02000]
 Other Transporters
  Pores ion channels [TC:1]
   Smlt3220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3263992..3264627)
Genome map
AA seq 211 aa AA seqDB search
MSTTLYGSTSTAALVVHWLLIELGIEHELVLLDFDAREHKSAQYLALNPAGVVPTLLIDG
LVLTEAAAIALYLADRHPDANLLPALGTPQRADAYRWMFWCANTLQPAYRAWFYPHEMAG
EANIEASRGMARQRLEAAWQHVAAHLHAHGPYLLGATPCVVDYMLVMLMRWSRNMPRPTD
TWPVLKAHATSMKARPAFAEVYRREGITDWL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacgctgtatggttcgaccagtaccgccgcgctggtggtgcactggctgctg
atcgagctgggcatcgagcatgaactggtgctgctggatttcgacgcgcgcgagcacaag
tcggcgcagtacctggcgctgaatccggccggtgtggtgccgacactgctgatcgatggc
ctggtactgaccgaagcggcggccattgcgttgtacctggctgatcgccatccggacgcc
aacctgctgcccgcgctgggcacgccgcagcgcgccgatgcctaccgctggatgttctgg
tgtgccaatacgctgcagccggcctatcgagcctggttctatccacacgaaatggcgggc
gaggcgaatatcgaggccagccgcggcatggcacggcagcgcctggaagcggcctggcag
catgtggccgcgcacctgcatgcacatggcccctacctgctgggcgccacgccctgcgtg
gtcgactacatgctggtgatgctgatgcgctggtcgcgcaacatgcccaggcccaccgac
acctggccggtactgaaggcgcacgccacgtcgatgaaggcgcgcccggcgttcgccgag
gtgtaccgccgcgaaggcatcaccgactggctgtaa

DBGET integrated database retrieval system