KEGG   Stenotrophomonas maltophilia K279a: Smlt3574Help
Entry
Smlt3574          CDS       T00718                                 

Definition
(GenBank) putative angiotensin-converting enzyme like peptidyl dipeptidase protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Brite
Enzymes [BR:sml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Smlt3574
Peptidases [BR:sml01002]
 Metallo Peptidases
  Family M2
   Smlt3574
Exosome [BR:sml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smlt3574
CD molecules [BR:sml04090]
 Proteins
  Smlt3574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3624781..3626745
Genome map
AA seq 654 aa AA seqDB search
MKHRHLLLASAIAAATLALAACKKEAAPGTDTASSSAPAGETADQFVARINAEFKAAYPE
MTSAQWLSSTYINSDSERIAAKANERSLTQLNSWIEQAAKFDGKPMSEDSKRAIHLLKLM
SSMPAPRDPAKLAELTQIATRMEGSYGAGKYCTDANDPNSCRQLGELEQVLARSRDYDKQ
LDAWQGWHSTTKSMRGDYQKFVGLVNEGAKGMGFTDAGQMWRSGYDMPPEQIGPETDRLW
EQVKPMYEQLHCYARGKLDKTYGKDKAEVGNGLIAAHLLGNMWQQDWSNLWDQLEPYPGA
GSLDITAALEKQYQTNLSAALAKAGKDANVAAQYKAQREAELRTAKQMTERAQDFYVSLG
MPSLPQSYWEKTQFIKPDDRDVVCHASAWDMNMEGDVRTKMCIKPNEENFTTIYHELGHI
YYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPKYLSSIGLVDAPTESREAVINNQMR
MALSGVSFLPFGLMIDRWRWGVFDGSITADNYNKAWWDLKAKYQGVAPASTRGEEFFDPG
AKYHVPGNTPYTRYFLARILQFQFYKGLCDASGYKGPLHECTFYGNKEAGQKYWAMLSKG
ASQPWQATLKELTGTDKLDAGPMIEYFTPVNEWLKQQNEGQMCGWQANAAPAAK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaccgtcatctcctgctggcctcggcaatcgccgccgccacgctggccctggcc
gcctgcaagaaggaagctgccccaggcaccgataccgccagcagcagcgccccggccggc
gaaaccgccgaccagttcgtggcccgcatcaatgccgaattcaaggccgcctacccggag
atgacctcggcgcagtggctgtcttccacctacatcaacagtgattccgaacgcatcgcg
gccaaggccaacgagcgctcgctgacccagctcaacagctggatcgagcaggccgccaag
ttcgatggcaagccgatgagcgaggacagcaagcgcgcgatccacctgctgaaactgatg
tcctcgatgccggcgccgcgcgatccggccaagctggccgagctgacccagatcgccacc
cgcatggaaggcagctacggcgctggcaagtactgcaccgacgccaacgatccgaactcg
tgccgccagctgggcgagctggaacaggtactggcgcgcagccgcgactacgacaagcag
cttgacgcctggcagggctggcacagcaccaccaagagcatgcgcggcgactaccagaag
ttcgtcggcctggtgaacgaaggcgccaagggcatgggcttcaccgatgccggccagatg
tggcgcagcggctacgacatgccgccggagcagatcggcccggaaaccgaccgcctgtgg
gaacaggtcaagccgatgtacgagcagctgcactgctacgcgcgcggcaagctggacaag
acctatggcaaggacaaggccgaagtaggcaatggcctgatcgccgcgcacctgctgggc
aacatgtggcagcaggactggtcgaacctgtgggaccagctggaaccgtacccgggcgcc
ggcagcctggacatcaccgcggcgctggaaaagcagtaccagaccaacctgagcgcggcg
ctggccaaggccggcaaggatgccaacgtggccgcgcagtacaaggcgcagcgcgaggcc
gaactgcgtaccgccaagcagatgaccgagcgcgcgcaggacttctacgtgtcgctgggc
atgccgtcgctgccgcagtcctactgggaaaagacccagttcatcaagcctgacgaccgc
gacgtggtctgccacgccagtgcctgggacatgaacatggaaggcgacgtgcgcaccaag
atgtgcatcaagccgaacgaagagaacttcaccaccatctaccacgagctgggccacatc
tattacgacctggcctacaacccgctgccgccgctgttccagggcggtgccaacgatggc
ttccatgaagcgatcggcgacaccatcgtgctggcgatgacgcccaagtacctcagctcg
atcggcctggtcgatgcgccgaccgaaagccgcgaggcggtcatcaacaaccagatgcgc
atggcgctgtcaggcgtgtcgttcctgccgttcgggctgatgatcgaccgctggcgctgg
ggcgtgttcgatggctcgatcactgccgacaactacaacaaggcgtggtgggacctgaag
gccaagtaccagggcgtggcgccggccagcacccgtggcgaagagttcttcgatccgggc
gcgaagtaccacgtgccgggcaacactccgtacacccgctacttcctggcgcgcatcctg
cagttccagttctacaagggcctgtgcgacgcgtccggctacaagggcccgctgcatgag
tgcaccttctacggcaacaaggaagccggccagaagtactgggcgatgctgagcaagggt
gccagccagccgtggcaggccacgctgaaggagctgaccggtactgacaagctcgatgcc
ggcccgatgatcgagtacttcaccccggtcaacgagtggctgaagcagcagaacgaaggc
cagatgtgcggctggcaggccaacgcggccccggcggcgaaatga

DBGET integrated database retrieval system