KEGG   Streptococcus macedonicus: SMA_1788Help
Entry
SMA_1788          CDS       T01674                                 

Gene name
yfbQ
Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
smn  Streptococcus macedonicus
Pathway
smn00220  Arginine biosynthesis
smn00250  Alanine, aspartate and glutamate metabolism
smn00290  Valine, leucine and isoleucine biosynthesis
smn01100  Metabolic pathways
smn01110  Biosynthesis of secondary metabolites
smn01130  Biosynthesis of antibiotics
smn01210  2-Oxocarboxylic acid metabolism
smn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMA_1788 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    SMA_1788 (yfbQ)
   00220 Arginine biosynthesis
    SMA_1788 (yfbQ)
Enzymes [BR:smn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SMA_1788 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     SMA_1788 (yfbQ)
Amino acid related enzymes [BR:smn01007]
 Aminotransferase (transaminase)
  Class I
   SMA_1788 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CCF03079
UniProt: H2A8H9
LinkDB All DBs
Position
complement(1732764..1733978)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPILDEANRMIANGEKILRLNTGNPAEFGFTAPDEVIRDLIA
NARNSEAYSDSKGIFSARKAIMQYCQLKGFPHIDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYFCDEKANWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPDELLKEIVEIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKNNVKGYIEGLNMLANMRLCANVLGQHVVQTSLGGYQSVDELL
IPGGRIYEQRNFIYKAINEVPGLSAVKPDAGLYIFPKIDREMYRIDDDEQFCLELLKQEK
VMLVPGKGFNWNEPDHFRIVYLPRVEELAKVQEKLTRVLNQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcttcaaagctggaacacgttgcttacgatatccgtggtccc
attcttgacgaagccaatcgtatgattgccaacggtgaaaaaatcttgcgtcttaatact
ggtaacccagctgaattcggctttacagcaccagacgaagtcattcgagacttgattgct
aatgcccgcaatagtgaagcttattcagatagtaaagggattttttctgcgcgtaaggca
attatgcaatattgtcagctaaaagggttcccacatatagatattgatgatatttatcta
ggaaatggtgtatctgaattgatttcaatgtctcttcaggcgcttcttgatgatggcgat
gaagtcttggtgccaatgcctgattatccattgtggacagcttgtgttagcttggcgggc
ggtaatgctgttcattatttttgtgatgaaaaagctaactggtatcctgatattgatgat
atcaaatcaaaaatcacttctaacacaaaagcgattgttgtgattaaccctaataaccca
acaggcgctttataccctgatgagcttcttaaagaaattgttgaaattgctcgtcaaaat
gatttgattatctttgctgatgaaatctatgatcgcttggtaatggacggtaaaaaacat
acagcaattgctagcttagcaccagatgttttctgtgtgtcaatgaatggtttatcaaaa
tctcaccgaatctgcggtttccgtgttggttggatggtcttatcaggtcctaaaaataat
gttaaaggctacattgaaggacttaatatgttggcaaacatgcgtctttgcgccaatgtt
ttaggtcaacatgttgttcaaacatcacttggtggctaccaatcagttgatgaattgtta
attcctggtggtcgaatctatgaacaacgtaactttatctataaagctatcaatgaagtt
ccagggctttcagctgtgaaaccagacgcaggactttacattttccctaaaatcgaccgt
gaaatgtatcggattgatgatgacgaacaattctgtttggaattattgaaacaagaaaaa
gtcatgttggttccgggtaaaggattcaactggaatgagccagaccacttccgtatcgtt
tatctaccacgcgtggaagaattggcaaaagttcaagaaaaattaacacgagtattaaat
caatatcgacgctaa

DBGET integrated database retrieval system