KEGG   Selaginella moellendorffii: SELMODRAFT_112650Help
Entry
SELMODRAFT_112650 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00230  Purine metabolism
smo00620  Pyruvate metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
smo01230  Biosynthesis of amino acids
Module
smo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smo_M00002  Glycolysis, core module involving three-carbon compounds
smo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
smo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_112650
   00620 Pyruvate metabolism
    SELMODRAFT_112650
  Nucleotide metabolism
   00230 Purine metabolism
    SELMODRAFT_112650
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SELMODRAFT_112650
Membrane trafficking [BR:smo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SELMODRAFT_112650
Exosome [BR:smo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SELMODRAFT_112650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 9647885
NCBI-ProteinID: XP_002980394
JGI: 112650
UniProt: D8SAU1
LinkDB All DBs
Position
Unknown
AA seq 509 aa AA seqDB search
MEGIFRSSSSDRASLAKTKIVCTLGPKSREIPILENLLRAGMNVARFNFSHGSHDYHRET
VSNLRAAMASTKILCAVMLDTKGPEIRTGMLKDGAPIQLKEGNVITITTDYSIQGNETTI
AMSYKRLAEDLAPGNVILCADGTITFTVVSCDPSAGTIVCRCENTAVLGERKNVNLPGVV
VDLPTVTEKDVKDILEWGIPNSIDFIALSFVRKAQDLINVRKLLSDHHPTAARTIQIISK
IENQEGLVNFDEILRESDAIMVARGDLGMEIPTEKIFLAQKMMIYKCNAAGKPVITATQM
LESMIKCPRPTRAEATDVANAVLDGTDAVMLSGETAAGLYPELAVATMAKICVEAENSLD
YPAIFKAIMDQSLLPLSPLESLASTAVQTAKEVKASLIVVLTRGGTTAKLVAKYRPMVPV
LSIAVPVVRTDSLTWWWSSESPARHSLVVRGLVPLLAQGDWKATEAESCEEIFGAAVKYA
VERKMCRAGESIIALQRIGDAAVIKIIAV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatctttcgctctagcagcagcgatcgcgcgtcactggccaagacgaagatc
gtgtgcacgctaggccccaagtctcgcgagatccccattctcgagaatctcctgcgcgcc
ggcatgaatgtggcgcgcttcaatttctcgcacggatctcacgactaccaccgcgaaacg
gtcagcaatctccgcgcggcgatggccagcacgaagatcctgtgcgccgtgatgctcgac
acgaaggggccagagattcgcactggaatgctcaaggatggagctccaatccagctgaaa
gaggggaatgtcatcacgatcaccacggactacagcatccagggcaacgagacgacgatc
gcgatgagctacaagcggctcgcggaggatctagctccagggaacgtgatcctctgcgcc
gacggcacgatcacgttcacggtggtctcctgcgatccaagcgccgggacgatcgtgtgc
cgctgcgagaacacggctgttcttggcgagaggaagaacgtcaatctcccaggcgtcgtc
gtggatcttccaaccgtgaccgagaaggacgtgaaggacatcctggagtggggcattccc
aatagcatcgatttcatcgctctctccttcgtccgcaaggcccaggatctgatcaacgtg
aggaagctcttgagcgatcatcaccccaccgcggcaagaacaatccagatcatctccaag
atcgagaaccaggaaggactggtgaacttcgacgagatcctccgtgagtcggacgcgatc
atggtggccaggggcgatctcggcatggagatcccaacggagaagatcttcctggcgcag
aagatgatgatctacaagtgcaacgccgctggaaagcccgtgatcaccgcgacgcagatg
ctagaatccatgatcaagtgcccgagacccacgagagccgaggccacggacgtcgccaac
gcagtcctcgacggcaccgacgcggtgatgctcagcggtgagaccgccgcggggctctat
ccggagctcgcggtagcaaccatggccaagatctgcgtcgaggccgagaactcgctcgac
tacccggccatcttcaaggcgatcatggatcaatcgctactgccgctcagcccgctcgag
agcctggcttccacggcggtccagacggccaaggaggtgaaagcttcgctcatcgtggtg
ctgacgcggggtggtaccacggcgaagctggtagcgaagtatcgaccaatggtaccggtt
ctatcgatcgcggtgccggtggtgaggacggatagcttgacgtggtggtggagtagcgag
tctccggcgcggcatagcttggtggtgaggggattggtgccattgctagcgcaaggagac
tggaaggcaacggaggcggagtcttgcgaggagatttttggggcggcggtgaagtatgct
gtggagaggaagatgtgccgagctggggaatcgattatagcgctccagaggattggggat
gctgcggtgatcaagatcattgcagtgtga

DBGET integrated database retrieval system