KEGG   Selaginella moellendorffii: SELMODRAFT_269944Help
Entry
SELMODRAFT_269944 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smo  Selaginella moellendorffii
Pathway
smo00620  Pyruvate metabolism
smo00710  Carbon fixation in photosynthetic organisms
smo01100  Metabolic pathways
smo01200  Carbon metabolism
Module
smo_M00168  CAM (Crassulacean acid metabolism), dark
smo_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SELMODRAFT_269944
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SELMODRAFT_269944
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SELMODRAFT_269944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 9629223
NCBI-ProteinID: XP_002992495
JGI: 269944
UniProt: D8TAC4
LinkDB All DBs
Position
Unknown
AA seq 955 aa AA seqDB search
MVSIDDRMRLLVPTKVTADDKLIEYDMLLLNHFLSVLKDLHGEEMRELVHRCYELSGQYG
QAEGCGDPAKLEDLGNLVKSLQPGPAIVIASSLSHMLNLGNLAEEVQIAHRRRVSEKSGG
IGDENSALTESDIEETFRRLMKLGKSPQEIFEALKTQTVDLVLTAHPTQSIRRSLLQKHS
RIRSCLSELYKDDITPDEKQELEEALHREVQAAFRTDEIRRTPPTPQDEMRAGMSYFHET
IWNCLPKFLRRVDTALKAIGINERLPYNVPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA
RLMASSLYFSQIEDLMFELSMWRCNEELRARVAQLELRTKEDAKHYKEFWKPIPSNEPFR
VILGDIRDRLYRTRERARQILATGKSDVNEEEAFSSVEEILEPLELCYRSLCSTGDKLIA
DGSLLDFMRQVSCFGLGLVRLDIRQESDRHTDVMDAITTHLGIGSYRSWTEEERQEWLLA
ELRGKRPLFGADLPKTDEIKDVLETFHVIAELPTDCFGAYIISMATAPSDVLVVELLQRE
CRVNVPLRVVPLFEKLADLEAAPASLTRLFSIDWYRNRIKGKQEVMIGYSDSGKDAGRFS
AAWQLYKCQEELVKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPRDTIDGSLRVTI
QGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPTAPKEDWRKLMDEMAAIATEAYRSVV
FKDPQFVHYFRMATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWL
GFGEAFKDVIDGNPQTLKMLQAMYREWPFFRVTVDLVEMVFAKGDPRIAELYDRLLVSPE
LQDIGKKLRGKYEETRKLLLEVACHSELLEENPTLKQRLRLREPFITTLNVQQAYTLKKM
RQIEPDDAPMPRTNANSASAEELVELNTTTEYAPGLEDTIILTMKGIAAGMQNTG
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggtttccatcgacgatcgcatgcgcctgctcgtcccgactaaggtcaccgccgatgac
aagctgatcgagtacgacatgctgctactcaatcacttcttgtcggtgctcaaggatctt
cacggcgaggaaatgcgggagctggtgcatcgctgctacgagctctccggtcagtatgga
caggccgaggggtgcggcgatccggcaaagctggaagatctgggcaatttggtgaagagc
ttgcagccagggccagcgattgtgattgcgagctcgctgtctcacatgctcaatctgggg
aacctggcggaggaggtccagattgctcatcgcaggagggtgagtgagaagtcgggaggg
attggcgacgagaacagcgctctcacggagtcagacatcgaggagactttccggaggctc
atgaaattgggaaagtcgccgcaagagattttcgaggccttgaagacacagacggtggat
ctcgtgctcactgcgcatccaacgcaatccatccgacgctcgctgctccaaaagcattcc
aggattcggagctgcctgtcggagctgtacaaagacgatatcactcccgatgagaagcag
gaactcgaagaggcgctccacagagaagtccaagcggcctttcggactgacgagattagg
cgcacaccaccaacacctcaggatgagatgcgagccggaatgagctacttccacgaaaca
atctggaattgtctccccaaatttctccggcgggtagacaccgcgctgaaagcgatcggg
ataaacgagcgactgccttacaatgtacctctcattcagttttcttcgtggatgggagga
gacagggatggtaatccccgtgtcactccggaagtaacaagggacgtgtgcttgttggca
aggctgatggcgtcaagtttgtacttttctcagattgaagatcttatgttcgagctctct
atgtggcggtgcaatgaggaacttcgtgctagagtggctcagctggaacttcgtacgaaa
gaggacgccaaacactacaaagagttttggaagccaattccttccaacgagcccttccgt
gttattcttggtgatatacgtgatagattgtatcggacgagagagcgtgctcgccaaatt
cttgcgactggaaagtccgacgtgaatgaagaagaggctttttcgtccgttgaggagatc
cttgaaccactggagctgtgttaccgctcgctatgctctactggcgacaaacttatagcg
gacggcagcttgctagatttcatgcgtcaggtctcttgctttggcctcggcttagtcagg
cttgacatcaggcaagagtcggaccggcacacggatgtaatggacgcaatcaccacgcac
ttgggcattggttcttaccggagctggacagaggaggagcgccaagagtggcttctagca
gagctacgcgggaagcgtccgttatttggagcagatttaccgaaaacagatgagatcaag
gatgtgcttgagacgttccatgtgattgcggagcttccaaccgactgttttggagcgtac
atcatctcaatggcgacggccccgtcggatgttttggtggtggaacttctccagcgcgag
tgccgcgtcaacgtgcctctgcgggtggttcccctgtttgagaagctggccgacttagag
gctgctcctgcaagcctcactcgcctcttttccatcgactggtaccgcaaccgcatcaaa
ggaaagcaggaggtaatgatcggctactctgactctgggaaggacgctggtcgtttttca
gcggcatggcagctttacaagtgccaggaagagcttgtcaaggtggcaaagcagtttggt
gttaagttgacgatgttccacggccgtggaggaaccgttggcagaggtggtggtccgacg
catttggctattctgtcacagcctcgggacaccatcgatggctcgctgcgtgtgaccatc
caaggcgaagttattgagcagtcctttggggaggagcacttgtgcttcagaacgctccaa
cgtttcacagctgcaacgctggagcacggaatgcatcctccgaccgcgccgaaagaagac
tggcggaaacttatggacgaaatggccgcgattgccacagaggcttaccgatccgtggtt
ttcaaagacccgcagttcgtgcactactttcgaatggcgacaccagagctggagtatgga
cgcatgaacattggaagccggccatccaagagaaagccaagcgggggtattgagtctctc
cgggcaatcccgtggatatttgcatggacgcagacgcggttccatcttccggtgtggctt
ggattcggtgaagcctttaaggatgtaattgacgggaatccacagacgctcaagatgctc
caggctatgtaccgcgagtggcctttcttccgggtcaccgtcgacctcgtggagatggtt
ttcgccaagggagacccccggattgccgagctatacgacaggctccttgtgtctccggag
ctgcaggacattgggaagaagctgagagggaaatacgaggaaacgcgaaagctcctccta
gaggtggcttgccactcggaacttcttgaggaaaacccgacgctcaagcagcggcttcga
ctccgtgagccattcatcacgacgctcaacgtgcagcaggcctacacgctgaagaagatg
cggcagatcgagccggacgatgcgccaatgccgaggaccaacgcaaacagcgcatcggcg
gaagagcttgtggagcttaacaccacaaccgagtacgctcctggcctggaagacaccatc
attctcaccatgaaaggaatcgcggcaggaatgcaaaacacgggatag

DBGET integrated database retrieval system