KEGG   Selaginella moellendorffii: SELMODRAFT_432224Help
Entry
SELMODRAFT_432224 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
smo  Selaginella moellendorffii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SELMODRAFT_432224
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SELMODRAFT_432224
Chromosome [BR:smo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SELMODRAFT_432224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 820 aa AA seqDB search
MANQERGLELGQRCDHQHSPLSAAAEDPEKDMAAGPRTKVYRRRFSSIRGIAVRPPVTRR
RRDDQWSSSRRFREQTSDPKVAFECLPLRPCDFRLPSSWIKRLDQESPPYIHIRRNVYLT
KKTPKVSKDDGMQCSCKGSKICSSDCICRLLYTSCSSSCACEGKCENLPFQKRDGRRLRL
KETENCGWGLFADENIERGDFLIEYIGEVIDDKTCEERLWDLKERGENNFYLCEVGHDKV
IDATFKGNMSRFINHSCNPNAQLRKWQCDGELRIGVFAVSRILKGQEITYDYKYIQFGTE
QQCHCGSKNCKGILGGSRPTKLQNQNVQGEMVQEKMDAPETQNFSKPREFKQIISDAPCM
EAVSPFAHSRNSVGHRVRVWWPLDQKYYSGRIIRYNASIGKHQILYDDGDEEEISLLEEK
WSWEKKNAHLLLESLLKSATPSLAEVKEIQKSIGLSSSGSRLDNLLIRAYAHCGSLDGSR
ELFDGMRERTLFSWSIMVAAHAQRGHLEEASAIHEKMPAWNVVCWNAMLAPLADSGRLDF
SARMFQAMPGRNAVSWTAAIAASARNGHLVWAMELFHKMPSTSEISWDSITRALALSGNL
DDARLYFHRSPARMSFATWMAIFQACARSGELDHAKALFDQAIERNEDSWSAMLWGYATQ
GSLRDSVAVLEKMPVVGVVSCSSLVQCYTQNGYIREAKALFDGLPARSEDTWTALAVGYA
RTGHLGEAGILTDRMPQRNLVCMAAILQAHEGDLHAAKGIFVEMPEKNYTCWNTLLTAYA
SADLFECVERVFKKMPMHCEVPSTPRMHCGSLDTWSRILA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccaggagagagggctggagctcggccagcgctgcgatcaccagcattctcct
ctatcggcagcagcggaagatccagagaaggacatggccgcgggtccaagaacgaaggtc
tatagaaggagattttcttcgatcagaggcatcgcagtgcgtcctccagtcactcgccgg
cggagagacgatcaatggagcagctctcgtcggtttcgagaacaaacgagtgatccaaag
gtagcattcgagtgtcttccactccggccttgcgattttcgtctaccttcttcttggatc
aagcgcctggaccaagaaagtcctccatatattcacataagacgcaatgtttatctcacg
aagaaaacgccgaaagtctccaaagacgatggaatgcagtgctcttgcaaaggatcaaaa
atctgctcgtcagactgcatttgcagattactgtacactagttgttcatccagctgcgct
tgtgaaggcaaatgcgagaatcttccttttcaaaagcgtgatggccggaggctaagactt
aaagagacggagaattgtggatggggtctttttgcggatgaaaatattgagcgaggcgat
tttttgatcgagtacattggcgaagtaattgacgacaagacgtgtgaagaaagattatgg
gatctgaaagaacgtggcgagaataacttctacctctgtgaagtcggtcacgacaaggtg
atcgacgcgaccttcaagggcaacatgtctcgatttatcaatcacagttgcaatcccaac
gcacaattgcgaaaatggcaatgcgatggagagcttagaatcggcgtgttcgcagtatct
cgtatattgaagggtcaggaaataacatacgattacaagtacattcaattcgggacggag
cagcagtgtcactgcggatccaaaaattgcaaagggatacttggcggctctaggccaact
aagctacagaatcagaatgtgcaaggagaaatggttcaggaaaagatggatgctccagaa
acgcagaacttttctaaaccaagggagttcaagcagataatctccgatgcaccatgtatg
gaagctgtgtctcctttcgcgcattcgaggaactctgtcggacacagagtacgagtatgg
tggcctctcgaccaaaaatactacagcggacggatcatacgctacaacgcctcgattggc
aaacatcagatactttacgatgatggtgacgaggaggagattagcttgctcgaggagaaa
tggtcatgggagaagaagaacgctcacctcctcctggaatccctgctcaagtctgccacg
ccatctctcgcggaagtgaaagagatccaaaaatcgatcggactatcatcctctggctct
cggcttgacaatcttttgatccgcgcgtacgcccactgtggaagcctcgatggatcgcgc
gagctcttcgatggaatgcgcgagcggacgctcttctcgtggtcgatcatggtggcggcg
cacgcccagagagggcatctggaagaagcatccgcgatccacgagaagatgcctgcctgg
aatgtcgtgtgctggaacgcgatgctggcgccactggcggattccgggcggctggacttt
tccgccagaatgttccaagcgatgccagggcggaatgccgtgtcctggacggcggcgatt
gctgcaagtgcccggaatgggcatctggtgtgggcgatggagctatttcacaagatgcct
tctacgagcgaaatctcttgggactccatcactagggcccttgctctgtcagggaatctc
gacgatgcgaggctctatttccatcgatcgcccgcaagaatgagctttgcgacttggatg
gcaatcttccaggcgtgtgccaggagtggcgagcttgatcacgcaaaagccctcttcgat
caagcgattgagaggaacgaggattcgtggagcgcgatgctctggggatatgccacgcag
gggagtctgagagattccgtggctgtgctggagaagatgcctgtggtgggagtggtctcg
tgctcgagcctcgtccagtgttatacccagaacgggtatattcgtgaggcgaaagcactc
tttgatggattgcccgcgagatcggaggacacgtggacggctctcgctgtgggatatgcc
cgcactgggcatcttggcgaagcggggattttgacggacaggatgccgcagaggaatctc
gtgtgcatggctgcgattttgcaggctcacgagggggatctccatgcagcaaagggaatc
tttgttgagatgccagagaagaactatacgtgttggaacacattgcttacggcctacgct
agtgccgatttgttcgaatgtgtggagcgagttttcaagaaaatgccgatgcattgcgag
gttccatccacaccgaggatgcactgcggatctttagatacttggagcaggatcttggct
tga

DBGET integrated database retrieval system