KEGG   Spirosoma montaniterrae: AWR27_17145Help
Entry
AWR27_17145       CDS       T04702                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
smon  Spirosoma montaniterrae
Pathway
smon00020  Citrate cycle (TCA cycle)
smon00310  Lysine degradation
smon00380  Tryptophan metabolism
smon01100  Metabolic pathways
smon01110  Biosynthesis of secondary metabolites
smon01120  Microbial metabolism in diverse environments
smon01130  Biosynthesis of antibiotics
smon01200  Carbon metabolism
Module
smon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smon00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWR27_17145
  Amino acid metabolism
   00310 Lysine degradation
    AWR27_17145
   00380 Tryptophan metabolism
    AWR27_17145
Enzymes [BR:smon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AWR27_17145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N ANT
Motif
Other DBs
NCBI-ProteinID: AQG80894
UniProt: A0A1P9WZV7
LinkDB All DBs
Position
complement(4006858..4009632)
Genome map
AA seq 924 aa AA seqDB search
MDQYSYIANSDAAYVDQLYQSFKQDPQSVDASWQQFFKGFEFSLTYGEHAGATTNGTNGT
TTTNGVATNGQAKPVDASHAEKEVSVASLIKAYRSRGHLLAKTNPLRERKDRQPRVDLPD
YALSDADLNTVFESGKLLGIGPATLRTIMESLRKIYAGNIGFEYMYIRDMEEKNWLRNKI
EKEALVFSPSATEKTRILEKLNEATVFENFLATKYLGQKRFSLEGGESTIPALDTIISTA
ADLGVEEVMIGMAHRGRLNVLVNILGKSYEAVFDGFEGNVPEDVHGDGDVKYHLGYSSLT
ETPSGKQISVKLAPNPSHLEAVNPVVEGFARAQGDEEYSGDFTKILPILIHGDAAVAGQG
IVYEVTQMAKLKGYQTGGTVHFVINNQVGFTTDFDDARSSIYCSDIAKIIDAPIFHVNGD
DPEAVIFCAKLAVEFRERFSRDVFIDMVCYRRYGHNESDEPKFTQPTMYNIIDKHANPRE
IYNKFLIERGDVDAELASRMDAEFKKQLQDRLDRVKQKAEIPYKPLRLDRDWAELRFSEP
ADFDQSPETGVPMDTIQAIGKALVRLPEGFKPLKQIEKLLKDRQAMLTETNMVNWGTAEL
LAYGSLLLDGKPVRLSGQDVQRGTFSHRHAVLHDIETNEVYSSLDHIQEGQRKFQVYNSL
LSEYGVLGFEYGYAMATPHALVIWEAQFGDFSNGAQTIIDQFIAAGESKWGIQNGVVMLL
PHGYEGQGPEHSNARPERYLQLYAEYNMVVANVTSPANFFHLLRRQVAWQFRKPLVVMSP
KSLLRHPKCVSPLEDLTKGSFQEVLGDSYANPKKVKRVLLCTGKVYYDLLDKQQADQRDD
VAIVRLEQLAPLPQKQLDAVLASYGKAERIWVQEEPENMGAWTYLLRSGMRLPIISRHAA
ASPATGFAKIHTQEQAEIVRRAFE
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatactcatatattgccaactccgacgcggcctacgtagatcaactgtaccag
tcttttaagcaagacccacagtcagttgatgcaagctggcagcaattttttaaaggattt
gaattttcacttacctacggcgaacacgccggtgcgaccaccaacggaacgaatggtaca
acaacgaccaacggcgtagctaccaatgggcaagccaagcccgttgatgccagccatgct
gagaaagaagtatcggttgccagcctgataaaagcctaccggtcaagggggcatttgctg
gcgaaaaccaatcccctgcgcgaacgcaaagaccgtcagccccgcgttgacctgcccgat
tacgcgctctccgatgcagatttaaatacggtttttgaatcgggaaaactgctcggtatt
ggccccgctacgctgcgaaccatcatggagtcgctgcggaaaatctatgcgggcaacatt
ggcttcgaatacatgtacatccgcgacatggaagagaaaaactggcttcggaacaaaatt
gagaaggaagccctcgttttctcgccttcagccacagaaaaaacgcgtatcctcgaaaag
ctgaacgaagccaccgtttttgagaactttctggcaaccaaatacttaggtcaaaaacga
ttctcgctcgaagggggtgaatcaaccattccagccttagataccatcattagtacggcg
gctgatctgggcgttgaagaagtaatgatcggtatggcacaccgggggcggctcaatgta
ttggttaacatactgggcaagtcctacgaagcggtgttcgatggctttgaaggtaatgta
cctgaagacgtacacggcgatggcgacgtgaaataccacctcggctactcgagtctgacc
gaaacgccatcgggcaagcaaatcagcgtaaaactggcccccaatccatcgcacctcgaa
gccgtgaacccggtggttgagggctttgcgcgggcacagggcgatgaagaatacagtggc
gactttaccaaaattctgcctattctgattcacggcgacgcggctgtggccggacagggt
attgtgtatgaagtgacgcagatggcgaagctgaaaggctaccaaaccggcggcacagta
cattttgtgatcaacaaccaggtgggtttcaccactgattttgatgatgcccgttcgtcg
atttactgctcagacattgccaaaattattgacgcgccgatttttcacgtcaacggcgat
gatcccgaagcggtaattttctgtgctaaactcgccgttgaatttcgcgaacgcttcagt
cgcgatgtgtttatcgatatggtttgttaccgtcgctacggccacaacgaatccgatgaa
ccgaagtttacgcagccgacgatgtacaacatcatcgacaaacacgctaacccacgcgag
atttacaacaagttccttattgaacggggcgacgtggatgccgaactggcgtcgcgcatg
gacgctgagttcaagaagcagttgcaggaccggctcgaccgtgtaaagcagaaagctgaa
atcccgtacaaaccgctccggctcgaccgcgactgggccgaactgcggtttagtgaaccg
gcagacttcgatcagtcgcccgaaaccggcgtaccgatggacacgatacaggccattggt
aaggcgttggtgaggttgcccgaaggcttcaaaccattgaagcagatcgaaaaactgctg
aaagaccggcaggcgatgctgaccgaaaccaacatggtgaactggggaacggcagagttg
ctggcttacgggtcgctgctgctcgatggcaaacctgtccgcctaagcggacaggacgta
cagcgtggcacgttctcacaccgccacgccgtgctacacgatatagaaaccaacgaggtg
tattcgtcgctcgatcatattcaggaagggcagcgaaaattccaggtttataattcgctg
ctgtcggagtatggcgtgctgggtttcgagtatggctacgcgatggcaacgccccatgcg
ctggttatctgggaagcacagttcggcgatttctcgaacggcgcgcaaaccattatcgac
cagtttattgccgctggcgaatcgaagtggggaattcagaatggggtggtgatgctgttg
ccgcacggctacgaggggcaaggtcccgaacactcgaacgcccggcccgagcgttacctg
caactgtatgccgagtataatatggtggtggcaaacgtaacttcgcccgccaacttcttc
cacctgttgcgtcggcaggtggcgtggcagttccgcaagccattggtggtaatgtcgccc
aaatcgttgttgcggcaccccaaatgcgtatcgccgttggaagacctgacgaaaggctca
ttccaggaggtgctgggcgatagctacgccaatccgaagaaggtgaagcgggtgttgctc
tgcacgggcaaggtttattatgacctgctcgataagcaacaggccgatcagcgcgacgac
gtagcgattgtgcggctggagcaactggctccactgccccaaaagcagttagacgccgtg
ttggcatcctacggtaaggccgagcgtatttgggtacaggaagaacctgaaaacatggga
gcctggacatacctgttgcgaagcggcatgcgcctgccgattatttcgcgccatgcggct
gcctcgccagctactggttttgccaaaattcatacgcaggaacaagccgaaatcgttcgg
agagcatttgaataa

DBGET integrated database retrieval system