KEGG   Sordaria macrospora: SMAC_01265Help
Entry
SMAC_01265        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
smp  Sordaria macrospora
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMAC_01265
   00051 Fructose and mannose metabolism
    SMAC_01265
   00052 Galactose metabolism
    SMAC_01265
   00500 Starch and sucrose metabolism
    SMAC_01265
   00520 Amino sugar and nucleotide sugar metabolism
    SMAC_01265
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SMAC_01265
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SMAC_01265
Membrane trafficking [BR:smp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SMAC_01265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 534 aa AA seqDB search
MALETQTKTVVGQFDYSDEDVNKGVTEFLRQMSEGLEKDGASLSQIPTYVTAVPNGTEKG
LYMAVDLGGTNFRVCSIQLNGDTTFRLTYTKVAIPKELMVAKTAEELFAFLAKQIEIFLR
THHGEHFEAHIRRRMTMSSPEGFKDENVFRLGFTFSFPVQQLGINKGTLIRWTKGFDIPD
AVGKDVCALLQTEIDKLHLPVKVAALVNDTVGTLMARSYSSPGKSGAILGAIFGTGTNGA
YVEKLSKLKKPLAGEYDNSTGEMVINTEWGSFDNQLKVLPNTPWDIQLDQATPNPGIQMY
EKRVSGMYLGEILRLAVIDLLKNPDVAFFRDENSSSNDWRSTTNIAEHSPLFKQWGVDTS
VLSVAAADTTPELSILRQELESNLHVYAPSLEDAQAFKAIACAIGRRAARLSAVAIAAIV
LQTGKLTDPELEGEPIDIGVDGSLVEHYPYFRDMIYEALRAIKGVGEEGAKRIRIGIAKD
GSGVGAALIALVAAGMEKTTSTTDFITDLRLNAKKTDLTAVPEHSELSELAAAE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgagactcagaccaagaccgttgtcggtcagttcgactactcggacgaggat
gtcaacaagggtgtcacagagttccttcgtcaaatgtccgaaggtctcgagaaggatggt
gctagcttgagccagattcccacatacgtcactgccgttcccaatggtaccgagaagggc
ctttacatggccgtcgaccttggcggcaccaacttccgtgtttgttcgatccagcttaac
ggcgacaccaccttccgtctcacatacaccaaggtcgccatccccaaagagcttatggtt
gccaagaccgctgaggaattgttcgctttcttggcgaagcagatcgaaatcttcctcagg
acacatcacggcgagcacttcgaggcacacatccggagacgcatgaccatgagctctccc
gagggcttcaaggacgagaacgtcttccgtctcggcttcactttcagcttccccgtccaa
caactgggtattaataagggtacactcattcgctggaccaagggtttcgacatcccagac
gccgttggaaaggatgtctgtgctctcctccaaaccgagattgacaagctccatctcccc
gtcaaggttgccgccctcgtcaacgacactgttggtactttaatggctcgctcctactct
tcccctggcaagagcggtgctatcctcggcgccatcttcggtactggcaccaacggtgct
tacgtcgagaagctctccaagctcaagaagcctttggccggcgagtacgacaattctacc
ggggagatggtcatcaacaccgagtggggctcgttcgacaaccagctcaaggtcctcccc
aacacaccatgggatatccagctcgatcaggccacccccaaccccggcattcagatgtac
gaaaagcgtgtctccggcatgtacctcggcgagatcttgcgattggcagtcatcgatctg
cttaagaacccagacgttgctttcttcagggacgagaactcgagctccaacgactggagg
tctaccaccaatattgccgaacactctcctctcttcaagcagtggggtgtcgatacctcg
gtcctgtctgtcgctgccgctgacactacccccgagttgtccatcctccgccaggagctc
gagtctaacctccacgtttatgccccatcgttggaggacgcccaggctttcaaggccatt
gcctgtgccatcggtcgccgcgctgctcgtctttcggctgttgccattgctgccatcgtt
cttcagaccggcaagctcaccgaccccgagctagaaggcgagcccatcgacattggtgtt
gacggaagcttggtcgagcactacccctacttccgcgacatgatctacgaggctcttcgt
gctattaagggcgttggtgaggagggtgccaagcgcatccgtattggtattgccaaggac
ggatctggtgttggtgccgctttgatcgctctcgtcgccgcgggaatggagaagaccact
tccaccaccgacttcatcaccgacctccgtctcaacgccaagaagaccgatctgacagcc
gtgcctgagcacagcgagcttagcgagcttgccgccgcggaatag

DBGET integrated database retrieval system