KEGG   Sinorhizobium meliloti BL225C: SinmeB_0719Help
Entry
SinmeB_0719       CDS       T01884                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smq  Sinorhizobium meliloti BL225C
Brite
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SinmeB_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEG03654
JGI: SinmeB_0719
UniProt: A0A0E0UAE1
LinkDB All DBs
Position
761909..762427
Genome map
AA seq 172 aa AA seqDB search
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaacgatgattgcgatcgcctgtgcggcaggaatggcgggtgccgcttcggca
caacagtcctcgcagacggcgacggccgagttcgtgggcaaggacggcacggacatcggc
cgggccactttgacggcaggcggcaagggcgtgctgatcgagatggagataagcggcctg
ccgaaggatacctgggtggcttttcacgctcacgaaatggggcgctgcgatcccaaggac
gggttcgagtcggcgggaaagcattttgccggcgaagatgagaatgccgagcacggcttc
ctcgcttccaatggcccgcatgccggcgacatgccgaaccagtatgtcggtgccgatgga
accttgcgcgcccaggtcttcaacagcttcgtgtccctcgacgacagggctaccgccctt
cgcggccgggccctggtgatccatgtgcattcggacgacaatcgcagccagccctccggc
gatgccggcgaccggctggcctgcgcggtggtgaagtag

DBGET integrated database retrieval system