KEGG   Sinorhizobium meliloti BL225C: SinmeB_1049Help
Entry
SinmeB_1049       CDS       T01884                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SinmeB_1049
Enzymes [BR:smq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SinmeB_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1095916..1096368)
Genome map
AA seq 150 aa AA seqDB search
MTLTFASPPQDKAELESGPAFTPRFDEKGLITAVVTDARDGELLMVAHMNAEALSLTLET
GFAHYYSRSRDRLWKKGESSGNLQTVREIRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVGVADGEAKVAITDDHRHFDPAQIYAGN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcacttttgcatcccccccgcaggacaaggccgaactggaaagcggcccggcc
ttcaccccgcgtttcgacgagaagggtctgatcacggccgtcgtgaccgatgcccgcgat
ggcgaattgctgatggtcgcgcatatgaacgccgaagcgctgtccctcacgctcgagacc
ggattcgcgcattactacagccgctcacgcgaccgcctctggaagaagggcgaaagctcg
ggcaatttgcagaccgtccgggaaatacgaaccgattgcgaccaggacgccgtctggttg
aaagtctcggtggccggccacgatgccacctgccataccgggcgccgctcgtgcttctat
cggacggtcggcgtcgccgatggcgaagcaaaagtggcgatcaccgacgaccacaggcat
ttcgatccggcgcagatctacgccggcaactga

DBGET integrated database retrieval system