KEGG   Stenotrophomonas maltophilia R551-3: Smal_2996Help
Entry
Smal_2996         CDS       T00733                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
Enzymes [BR:smt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Smal_2996
Peptidases [BR:smt01002]
 Metallo Peptidases
  Family M2
   Smal_2996
Exosome [BR:smt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smal_2996
CD molecules [BR:smt04090]
 Proteins
  Smal_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3337967..3339931
Genome map
AA seq 654 aa AA seqDB search
MKHRHLLLASAIAAATLALAACKKEAAPGTDTASSSAPAGETADQFVARINAEFKAAYPE
MTSAQWLSSTYINSDSERIAAKANERSLTQLNSWIEQAARFDGKPMSEDSKRAIHLLKLM
SSMPAPRDPAKLAELTQIATRMEGSYGAGKYCTDANDPNSCRQLGELEQVLARSRDYDKQ
LDAWQGWHSTTKSMRGDYQKFVGLVNEGAKGMGFTDAGQMWRSGYDMPPEQIGPETDRLW
EQVKPMYEQLHCYARGKLDKTYGKDKAEVGNGLIAAHLLGNMWQQDWSNLWDQLEPYPGA
GSLDITAALEKQYQTNLSAALAKAGKDANVAAQYKAQREAELRTAKQMTERAQDFYVSLG
MPSLPQSYWEKTQFIKPDDRDVVCHASAWDMNMEGDVRTKMCIKPNEENFTTIYHELGHI
YYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPKYLSSIGLVDAPTESREAVINNQMR
MALSGVSFLPFGLMIDRWRWGVFDGSITADNYNKAWWDLKAKYQGVAPASTRGEEFFDPG
AKYHVPGNTPYTRYFLARILQFQFYKGLCDASGYKGPLHECTFYGNKEAGQKYWAMLSKG
ASQPWQATLKELTGTDKLDAGPMIEYFSPVNEWLKQQNEGQMCGWQANAAPAAK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaccgtcatctcctgctggcctcggcaatcgccgccgccacgctggccctggcc
gcctgcaagaaggaagctgcgccaggcaccgataccgccagcagcagcgccccggccggc
gaaaccgccgaccagttcgtggcccgcatcaatgccgaattcaaggccgcctacccggag
atgacctcggcgcaatggctgtcctccacctacatcaacagtgattcggaacgcatcgcg
gccaaggccaacgagcgctcgctgacccagctcaacagctggatcgaacaggccgccagg
ttcgatggcaagccgatgagcgaggacagcaagcgcgcgatccacctgctgaagctgatg
tcctcgatgccggcaccgcgtgacccggccaagctggccgagctgacccagatcgccacc
cgcatggaaggcagctacggcgccggcaagtactgcaccgatgccaacgatccgaactcc
tgccgccagctgggcgaactggaacaggtgctggcgcgcagccgcgactacgacaagcag
ctcgacgcctggcagggctggcacagcaccaccaagagcatgcgcggcgactaccagaag
tttgtcggcctggtgaacgaaggtgccaagggcatgggcttcaccgatgccgggcagatg
tggcgcagcggctacgacatgccgccggagcagatcggcccggaaaccgaccgcctgtgg
gaacaggtcaagccgatgtacgagcagctgcactgctatgcacgcggcaagctggacaaa
acctacggcaaggacaaggccgaagtgggcaacggcctgatcgccgcgcacctgctgggc
aacatgtggcagcaggactggtcgaacctgtgggaccagctggaaccgtacccgggtgcc
ggcagcctggacatcaccgctgcgcttgaaaagcagtaccagaccaatctgagcgcggcg
ctggccaaggccggcaaggatgccaacgtagcggcgcagtacaaggcgcagcgcgaggcc
gaactgcgcaccgccaagcagatgaccgagcgcgcgcaggacttctacgtgtcgctgggc
atgccatcgctgccgcagtcctactgggaaaaaacccagttcatcaagcccgatgaccgc
gacgtggtctgccacgccagtgcctgggacatgaacatggaaggcgatgtgcgcaccaag
atgtgcatcaagccgaacgaagagaacttcaccaccatctaccacgagctgggccacatc
tattacgacctggcctacaacccgctgccgccgctgttccagggcggtgccaacgatggc
ttccatgaagcaatcggtgacaccatcgtgctggcgatgacgcccaagtacctcagctcg
atcggcctggtcgatgcgccgaccgaaagccgcgaggcggtcatcaacaaccagatgcgc
atggcgctgtcgggcgtgtcgttcctgccgttcgggctgatgatcgaccgctggcgctgg
ggcgtgttcgatggctccatcaccgccgacaactacaacaaggcgtggtgggacctgaag
gccaagtaccagggcgtggccccggcaagcacgcgaggcgaggagttcttcgatccaggc
gcgaagtaccacgtgccgggcaacaccccgtacacccgctacttcctggcgcgcatcctg
cagttccagttctacaagggcctgtgcgatgcctccggctacaagggcccgttgcatgag
tgcaccttctacggcaacaaggaagccggccagaagtactgggcgatgctgagcaagggt
gccagccagccgtggcaggccacactgaaggagctgaccggtaccgacaagctcgatgcc
ggcccgatgatcgagtacttcagcccggtcaacgaatggctgaaacagcagaacgaaggc
cagatgtgcggctggcaggccaacgcggccccggcggcgaaatga

DBGET integrated database retrieval system