KEGG   Streptococcus mutans UA159: SMU_129Help
Entry
SMU_129           CDS       T00100                                 

Gene name
adhC
Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E2 subunit
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_129 (adhC)
   00020 Citrate cycle (TCA cycle)
    SMU_129 (adhC)
   00620 Pyruvate metabolism
    SMU_129 (adhC)
Enzymes [BR:smu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMU_129 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
131203..132570
Genome map
AA seq 455 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDEVKEGEILLEIMSDKTNMEIEAEDSGVLLKIV
KGNGQVVPVTEVIGYIGQAGEVLEIADVPASTVPKENSAAPAEKTKAMSSPTVAAAPQGK
IRATPAARKAARDLGVNLNQVSGTGAKGRVHKEDVESFKAAQPKATPLARKIAIDKGIDL
ASVSGTGFGGKIIKEDILNLFEAAQPVNDVSDPAKEAAALPEGVEVIKMSAMRKAVAKSM
VNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMEKTGFKVSFTDLIGLAVVKTLMKPEHR
YLNASLINDATEIELHQFVNLGIAVGLDEGLLVPVVHGADKMSLSDFVIASKDVIKKAQT
GKLKATEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIQTPTVVDGEIKIRPIM
ALCLTIDHRLVDGMNGAKFMVDLKKLMENPFTLLI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaattattatgcctaaacttggtgttgatatgcaggaaggcgaaatcatc
gagtggaaaaaacaagaaggtgatgaggtcaaagaaggggagatcctccttgagattatg
tctgacaagaccaatatggaaatcgaagctgaggattcaggtgtcctgcttaagattgtt
aaaggaaatggtcaagttgttcctgtaactgaggtcattggttatattggtcaagcaggt
gaagttcttgaaatagctgatgttcctgcaagtacagttcctaaagaaaatagtgcagca
cctgctgaaaaaacaaaagcaatgtcttctccgacagttgcagcagcccctcaaggaaag
attcgagcaacaccagcagctcgtaaggcggctcgtgatctgggagttaacctgaatcag
gtttcagggacaggcgctaaaggccgtgttcacaaggaagatgttgaaagctttaaagca
gctcagcctaaagcaacaccattagctaggaaaattgctatagataaaggtattgatcta
gccagtgtctcaggaacaggttttggcggcaaaattatcaaggaagatattttaaatctg
tttgaggcagctcagcctgttaatgatgtgtcagatcctgctaaagaagcagctgcctta
ccagagggtgttgaagtcattaagatgtctgccatgcgtaaggcagtggctaaaagcatg
gtcaattcttacctgacagctccaacttttactctcaattatgacattgacatgactgag
atgattgcgttgcgtaaaaagttaattgatcctatcatggaaaaaacaggttttaaagtt
agcttcacagatttgattggtctggcagtcgtaaaaaccttaatgaaaccagaacatcgt
tacctcaatgcttcactcattaatgacgcgactgagattgaacttcatcaatttgttaac
cttggtatcgccgttggacttgatgaaggactgttagtacctgttgttcatggtgcagat
aagatgagcttgtcagattttgttatagcttcaaaggatgtcattaagaaagctcagacc
ggtaaattaaaagccactgaaatgtctggttcaaccttttccattacaaacttggggatg
tttggcactaagactttcaaccccattatcaatcagccaaattcggctattttgggtgta
ggagcaactatccaaacgccaactgttgtggatggtgaaattaagattcgtccaatcatg
gcactgtgcttgaccatcgatcaccgcttggttgatggcatgaacggcgctaagttcatg
gttgatcttaaaaaactgatggaaaatccatttacattattgatttga

DBGET integrated database retrieval system