KEGG   Streptococcus mutans UA159-FR: SMUFR_0520Help
Entry
SMUFR_0520        CDS       T03797                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua00473  D-Alanine metabolism
smua00550  Peptidoglycan biosynthesis
smua01100  Metabolic pathways
smua01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smua00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMUFR_0520
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMUFR_0520
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SMUFR_0520
Enzymes [BR:smua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SMUFR_0520
Peptidoglycan biosynthesis and degradation proteins [BR:smua01011]
 Precursor biosynthesis
  Amino acid ligase
   SMUFR_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AJD54995
LinkDB All DBs
Structure
PDB: 

Jmol
Position
557687..558736
Genome map
AA seq 349 aa AA seqDB search
MSKETLVLLYGGRSAERDVSVLSAESVMRAINYDNFLVKTYFITQAGDFIKTQEFDSQPS
ETDKLMTNDTIIASQKIKPSDIYEEEAVVFPVLHGPMGEDGSIQGFLEVLKMPYVGTNIL
SSSVAMDKITTNQVLESATTIPQVAYVALIEGEPLESKLAEVEEKLIYPVFVKPANMGSS
VGISKAENRTDLKQAIALALKYDSRVLIEQGVDAREIEVGILGNTDVKTTLPGEIVKDVA
FYDYEAKYIDNKITMAIPAEIDPVIVEKMRDYAATAFRTLGCCGLSRCDFFLTEDGKVYL
NELNTMPGFTQWSMYPLLWENMGLSYSVLIEELVSLAKEMFDKRESHLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacgcttgttttattatatggtggccgttctgcagaacgcgatgtttct
gtgctctcagctgagagtgtcatgcgagccataaattatgacaactttttagtcaaaact
tatttcattacgcaagcgggtgactttattaagacgcaagaatttgatagtcaaccatca
gaaactgataaactgatgacaaatgacacgattattgcttctcaaaaaattaagccaagt
gatatttatgaggaagaagcagttgtttttcctgttcttcatgggcctatgggagaggat
ggttctattcagggctttcttgaagttttaaaaatgccttatgtgggaaccaatattctg
tcatctagtgtagctatggataagattacaacaaaccaagttttagaaagtgcgactact
attcctcaagtagcttatgttgctcttattgaaggcgagcctttagaaagcaagttggca
gaagttgaagagaaattgatttatcctgtatttgttaagccagctaatatgggttctagt
gttggtatttctaaagcagaaaatcgcactgacttaaaacaagctattgcacttgctttg
aagtatgacagtcgtgttttaattgaacaaggtgtggatgcgcgtgagattgaggttggt
attttaggaaatactgatgttaaaacaactttaccgggagagattgtcaaagatgtggct
ttttatgattacgaagccaagtatattgataataagatcaccatggctattccggcagaa
atagatcctgttatcgttgaaaaaatgcgggattatgctgcaacagctttccgaactttg
ggctgctgtggactttctcgctgtgatttcttcctaacagaggatgggaaagtttatttg
aatgaactcaacactatgcccggctttactcagtggtctatgtatcctcttctttgggaa
aatatggggctgtcttattcagttttgattgaagaattagttagtcttgctaaagaaatg
tttgataaacgcgaaagccatttggtttaa

DBGET integrated database retrieval system