KEGG   Stackebrandtia nassauensis: Snas_5665Help
Entry
Snas_5665         CDS       T01194                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Snas_5665
Enzymes [BR:sna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Snas_5665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(6021089..6022402)
Genome map
AA seq 437 aa AA seqDB search
MSSKPTVYVGMSADLVHPGHINILQRAAELGDVTIGLLTDAAIASYKRLPHMTYEQRKAV
VENIKGVAAVVPQETLDYVENLEKLKPNFVVHGDDWKTGVQQQTRQRVIDALAQWNGELV
EVGYTEGISSTQLNESVKEVGTTPNVRLSRLRRLIENKPIVRIMESHSPLTGLIIETTTA
EHNGRKVEFDGMWSSSLTDSTARGKPDIELVDPASRMQGINDLFDVTTKPLIYDGDTGGK
PEHFSYTVRSLERLGVSAIIIEDKEGLKRNSLFGTGAQQTQCSIEDMVHKIQVGKKAQVT
KDFMVIARIESLILEQGMDDAVKRARAYIDEGGVDGIMIHSRQKTPDEVFEFCELFQKFP
KRVPLVVVPTSYNTVVEDEFAKRGVNVVIYANQLMRASYKAMASVATSILENGRSAEVDS
QIANIKEALAIIPENLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgagcaagcccaccgtctatgtggggatgagcgccgatctcgtccatcccgggcac
atcaacatcctgcaaagggccgccgagctgggcgacgtcaccatcggtctgctgaccgac
gcggccatcgccagctacaagcgcctgccccacatgacctacgaacagcgcaaggctgtc
gtggagaacatcaagggcgtcgcggcggtggtgccacaggagaccctcgactacgtcgag
aacctcgagaagctcaagccgaacttcgtcgtccacggtgacgactggaagaccggcgtt
cagcagcagacccggcagcgggtcatcgacgcgctcgcccagtggaacggcgaactggtc
gaggtcggctacaccgagggcatctcgtccacccagctcaacgagtccgtcaaagaggtc
ggcaccaccccgaacgtacggctgtcgcgactgcgccgcctgatcgagaacaagccgatc
gtgcggatcatggaatcgcacagcccgctgaccggtctcatcatcgagaccaccaccgcc
gagcacaatggacgcaaggtcgagttcgacggcatgtggtcctcctcgctgaccgactcc
accgcgcgcggcaagcccgacatcgagctggtcgaccccgcctcccggatgcagggcatc
aacgacctgttcgacgtcaccaccaagccgctgatctacgacggtgacaccggcggcaag
ccggagcacttcagctacaccgtgcgttcccttgagcgccttggtgtctcggcgatcatc
atcgaggacaaagagggcctgaagcgcaactcgctgttcggcaccggcgcccagcagacc
cagtgctccatcgaggacatggtccacaagatccaggtcggcaagaaggcccaggtcacc
aaggacttcatggtcatcgcgcgcatcgagtcgctgatcctggagcagggcatggacgac
gccgtgaagcgtgcccgcgcctacatcgacgagggcggcgtcgacggcatcatgatccac
tcgcgacagaagacccccgacgaggtcttcgagttctgtgagctgttccagaagttcccc
aagcgggttccgctggtggtcgtgccgaccagctacaacaccgtcgtcgaggacgagttc
gccaagcgcggcgtcaacgtcgtcatctacgccaaccagctgatgcgcgcctcctacaag
gccatggcctcggtcgccacctccatcctggagaacggccggtccgccgaggtcgactcg
cagatcgcgaacatcaaggaagccctggcgatcatcccggagaacctggcatga

DBGET integrated database retrieval system