KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11048Help
Entry
HMPREF0837_11048  CDS       T01259                                 

Definition
(GenBank) superoxide dismutase, Mn/Fe family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Brite
Enzymes [BR:snc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HMPREF0837_11048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADI69276
UniProt: D6ZRN7
LinkDB All DBs
Position
966273..966878
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattatcttaccagaacttccatatgcatacgacgctttggaaccatacatcgat
gcggaaacaatgcatttgcaccatgacaaacaccatcaaacttatgtcaacaatgccaat
gcagctttagaaaaacaccctgaaatcggtgaagaccttgaagccttgcttgctgatgta
gaatctatcccagctgatatccgtcaagcacttatcaacaatggtggcggacacttgaac
cacgctcttttctgggaattgatgactcccgagaaaacagctccttcagcagaactagca
gcagcaatcgatgcaacatttggttcatttgaagaatttcaagcagccttcactgcagca
gcaacaactcgttttggttcaggttgggcatggttggttgtcaacaaagaagggaaactt
gaagtgacttcaacagcaaaccaagacacaccaatctcagaaggtaaaaaaccaatcttg
ggcttggacgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactac
atcaaagctttcttttcagtaatcaactggaataaagtagatgaattgtacgcagctgct
aaataa

DBGET integrated database retrieval system