KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11935Help
Entry
HMPREF0837_11935  CDS       T01259                                 

Definition
(GenBank) Gram-positive signal peptide protein, YSIRK family
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    HMPREF0837_11935
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0837_11935
Enzymes [BR:snc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     HMPREF0837_11935
Bacterial toxins [BR:snc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   HMPREF0837_11935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1775859..1778801)
Genome map
AA seq 980 aa AA seqDB search
MSYFRNRDIDIERISMNRSVQERKCRYSIRKLSVGAVSMIVGAVVFGTSPVLAQEGASEQ
PLANETQLSGESSTLTDTEKSQPSSETELSGNKQEQERKDKQEEKIPRDYYARDLENVET
VIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKD
EYFTMAVYNNTATLEGRGSDGKQFYGNYNDAPLKVKPGQWNSVTFTVEKPTPELPKGRVR
LYVNGVLSRTSLKSGNFIKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEE
VQKRSQLFKRSDLEKKLPEGAVLTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLI
AGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTITNLRDNPKAFDPSIGSPVNIDMVL
VQDPETKRIFSIYDMFPEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGT
VYTPDGKATDYRVVVDPVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSY
SDDDGKTWSAPQDITPMVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNG
SQSSRVIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTMNNKRAQNTESTVVQLNNGDVKL
FMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQMSAIHTMHNGKEYIILSNAGGPN
RENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLS
FRKFNWEFLSKDLISPTEAKVKRTREMGKGEMGKGVIGLEFDSEVLVNKAPTLQLANGKT
ATFLTQYDSKTLLFAVDKEDIGQEIIGIAKGSIESMHNLPVNLAGARVPGGVNGSKAAVH
EVPEFTGGVNGTEPAVHEIAEYKGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLA
SLGLTAFFLGLFTLGKKREQ
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttcagaaatcgggatatagatatagagaggatcagtatgaatcggagtgtt
caagaacgtaagtgtcgttatagcattaggaaactatcggtaggagcggtttctatgatt
gtaggagcagtggtatttggaacgtctcctgttttagctcaagaaggggcaagtgagcaa
cctctggcaaatgaaactcaactttcgggggagagctcaaccctaactgatacagaaaag
agccagccttcttcagagactgaactttctggcaataagcaagaacaagaaaggaaagat
aagcaagaagaaaaaattccaagagattactatgcacgagatttggaaaatgtcgaaaca
gtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcagagagttgatttatca
agtgaactagataaactaaagaaacttgaaaacgcaacagttcacatggagtttaagcca
gatgccaaggctccagcattctataatctcttttctgtgtcaagtgctactaaaaaagat
gagtacttcactatggcagtttacaataatactgctactctagaggggcgtggttcggat
gggaaacagttttacggtaattacaacgatgcacccttaaaagttaaaccaggtcagtgg
aattctgtgactttcacagttgaaaaaccgacaccagaactacctaaaggccgagtgcgc
ctctacgtaaacggggtattatctcgaacaagtctgaaatctggcaatttcattaaagat
atgccagatgtaacgcatgtacaaatcggagcaaccaagcgtgccaacaatacggtttgg
gggtcaaatctacagattcggaatctcactgtgtataatcgtgctttaacaccagaagag
gtacaaaaacgtagtcaactttttaaacgctcagatttagaaaaaaaactacctgaagga
gcggttttaacagagaaaacggacatattcgaaagcgggcgtaacggtaaaccaaataaa
gatggaatcaagagttatcgtattccagcacttctcaagacagataaaggaactttgatc
gcaggtgcagatgaacgccgtctccattcgagtgactggggtgatatcggtatggtcatc
agacgtagtgaagataatggtaaaacttggggtgaccgagtaaccattaccaacttacgt
gacaatccaaaagcttttgacccatcgatcggttcaccagtgaatatcgatatggtgttg
gttcaagatcctgaaaccaaacgaatcttttctatctatgacatgttcccagaagggaag
ggaatctttggaatgtcttcacaaaaagaagaagcctacaaaaaaatcgatggaaaaacc
tatcaaatcctctatcgtgaaggagaaaagggagcttataccattcgagaaaatggtact
gtctatacaccagatggtaaggcgacagactatcgcgttgttgtagatcctgttaaacca
gcctatagcgacaagggtgatctatacaagggtaaccaattactaggcaatatctacttc
acaacaaacaaaacttctccatttagaattgccaaggatagctatctatggatgtcctac
agtgatgacgacgggaagacatggtcagcgcctcaagatattactccgatggtcaaagcc
gattggatgaaattcttgggtgtaggtcctggaacaggaattgtacttcggaatgggcct
cacaagggacggattttgataccggtttatacgactaataatgtatctcacttaaatggc
tcgcaatcttctcgtgtcatctattcagatgatcatggaaaaacttggcatgctggagaa
gcggtcaacgataaccgtcaggtagacggtcaaaagatccactcttctacgatgaacaat
aaacgtgcgcaaaatacagaatcaacggtggtacaactaaacaatggagatgttaaactc
tttatgcgtggtttgactggagatcttcaggttgctacaagtaaagacggaggagtgact
tgggagaaggatatcaaacgttatccacaggttaaagatgtctatgttcaaatgtctgct
atccatacgatgcataatggaaaagaatacattatcctcagcaatgcaggtggaccgaat
cgtgaaaatgggatggtccacttggcacgtgtcgaagaaaatggtgagttgacttggctc
aaacacaatccaattcaaaaaggagagtttgcctataattcgctccaagaattaggaaat
ggggagtatggcatcttgtatgaacatactgaaaaaggacaaaatgcctataccctatca
tttagaaaatttaattgggaatttttgagcaaagatctgatttctcctaccgaagcgaaa
gtgaagcgaactagagagatgggcaaaggagagatgggcaaaggagttattggcttggag
tttgactcagaagtattggtcaacaaggctccaacccttcaattggcaaatggtaaaaca
gcgactttcctaacccagtatgatagcaagaccttgttgtttgcagtagataaggaagat
atcggacaggaaattattggtatagctaaaggaagcatcgaaagtatgcataatcttcct
gtaaatctagcaggtgccagagttcctggcggagtaaatggtagcaaagcagcggtgcat
gaagttccagaatttacagggggagttaatggtacagagccagctgttcatgaaatcgca
gagtataagggatctgattcgcttgtaactcttactacaaaagaagattatacttacaaa
gctcctcttgctcagcaggcacttcctgaaacaggaaacaaggagagtgacctcctagct
tcactaggactaacagctttcttccttggtctgtttacgctagggaaaaagagagaacaa
taa

DBGET integrated database retrieval system