KEGG   Streptococcus pneumoniae ST556: MYY_1610Help
Entry
MYY_1610          CDS       T02087                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snd00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYY_1610
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MYY_1610
Enzymes [BR:snd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     MYY_1610
Bacterial toxins [BR:snd02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   MYY_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1585606..1587699)
Genome map
AA seq 697 aa AA seqDB search
MNKRGLYSKLGISVVGISLLMGVPTLIHANELNYGQLSISPIFQGGSYQLNNKSIDISPL
LLDKLSGESQTVVMKFKADKPNSLQALFGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQ
KGINYLFSRPASLWGKHKGQAVENTLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNI
NGIDKATLGAVNREGKEHYLAKGSIDEISLFNKAISDQEVSNIPLSNPFQLIFQSGDSTQ
ANYFRIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFND
YEEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADS
GFKEINGHYYLKLKKNGDNDFRYTVRENGVVYDETTNKPTNYTINDKYEVLEGGKSLTVE
QYSVDFDSGSLRERHNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPF
LGEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFKNATA
EAQMVELRDGVIRTFFRTTTGKIAYMTSRDSGETWSEVSYIDGIQQTSYGTQVSAIKYSQ
LIDGKEAVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELP
NHHIGVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagaggtctttattcaaaactaggaatttctgttgtaggcattagtctttta
atgggagtccccactttgattcatgcgaatgaattaaactatggtcaactgtccatatct
cctatttttcaaggaggttcatatcaactgaacaataagagtatagatatcagccctttg
ttattagataaattgtctggagagagtcagacagtagtaatgaaatttaaagcagataaa
ccaaactctcttcaagctttgtttggcctatctaatagtaaagcaggttttaaaaataat
tacttttcaattttcatgagagattctggtgagataggtgtagaaataagagacgcccaa
aagggaataaattatttattttctagaccagcttcattatggggaaagcataaaggacag
gcagttgaaaatacactagtatttgtatctgattctaaagataaaacatacacaatgtat
gttaatggaatagaagtgttctctgaaacagttgatacatttttgccaatttcaaatata
aatggtatagataaggcaacactaggagctgttaatcgtgaaggtaaggaacattacctc
gcaaaaggaagtattgatgaaatcagtctatttaacaaagcaattagtgatcaggaagtt
tcaaatattcccttgtcaaatccctttcagttaattttccaatcaggagattctactcaa
gctaactattttagaataccgacactatatacattaagtagtggaagagttctatcaagt
attgatgcacgttatggtgggactcatgattctaaaagtaagattaatattgccacttct
tatagtgatgataatgggaaaacgtggagtgagccaatttttgctatgaagtttaatgac
tatgaggagcagttagtttactggccacgagataataaattaaagaatagtcaaattagt
ggaagtgcttcattcatagattcatccattgttgaagataaaaaatctgggaaaacgata
ttactagctgatgttatgcctgcgggtattggaaataataatgcaaataaagccgactca
ggttttaaagaaataaatggtcattattatttaaaactaaagaagaatggagataacgat
ttccgttatacagttagagaaaatggtgtcgtttatgatgaaacaactaataaacctaca
aattatactataaatgataagtatgaagttttggagggaggaaagtctttaacagtcgaa
caatattcggttgattttgatagtggctctttaagagaaaggcataatggaaaacaggtt
cctatgaatgttttctacaaagattcgttatttaaagtgactcctactaattatatagca
atgacaactagtcagaatagaggagagagttgggaacaatttaagttgttgcctccgttc
ttaggagaaaaacataatggaacttacttgtgtcctggacaaggtttagcattaaaatca
agtaacagattgatttttgcaacatatactagtggagaactaacctatctcatttctgat
gatagtggtcaaacatggaagaaatcctcagcttcaattccgtttaaaaatgcaacagca
gaagcacaaatggttgaactgagagatggtgtgattagaacattctttagaaccactaca
ggtaagatagcttatatgactagtagagattctggagaaacatggtcggaagtttcgtat
attgatggaatccaacaaacttcatatggcacacaagtatctgcaattaaatactctcaa
ttaattgatggaaaagaagcagtcattttgagtacaccaaattctagaagtggccgtaag
ggaggtcaattagttgtcggtttagtcaataaagaagatgatagtattgattggaaatac
cactatgatattgatttgccttcgtatggttatgcctattctgcgattacagaattgcca
aatcatcacataggtgtactgtttgaaaaatatgattcgtggtcgagaaatgaattgcat
ttaagcaatgtagttcagtatatagatttggaaattaatgatttaacaaaataa

DBGET integrated database retrieval system