KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F06880Help
Entry
SPN23F06880       CDS       T00843                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Brite
Enzymes [BR:sne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPN23F06880 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAR68533
LinkDB All DBs
Position
676042..676647
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattatcttaccagaacttccatatgcatacgacgctttggaaccatacatcgat
gcggaaacaatgcatttgcaccatgacaaacaccatcaaacttatgtcaacaatgccaat
gcagctttagaaaaacaccctgaaatcggtgaagaccttgaagccttgcttgctgatgta
gaatctatcccagctgatatccgtcaagcacttatcaacaatggtggcggacacttgaac
cacgctcttttctgggaattgatgactcccgagaaaacagctccttcagcagaactggca
gcagcaatcgatgcaacatttggttcatttgaagaattccaagcagccttcactgcagca
gcaacaactcgttttggttcaggttgggcatggttggttgtcaacaaagaagggaaactt
gaagtgacttcaacagcaaaccaagacacaccaatctcagaaggtaaaaaaccaatcttg
ggcttggacgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactac
atcaaagctttcttttcagtaatcaactggaataaagtagatgaattgtacgcagctgct
aaataa

DBGET integrated database retrieval system