KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F14530Help
Entry
SPN23F14530       CDS       T00843                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Brite
Translation factors [BR:sne03012]
 Eukaryotic Type
  Elongation factors
   SPN23F14530 (tufA)
 Prokaryotic Type
   SPN23F14530 (tufA)
Mitochondrial biogenesis [BR:sne03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SPN23F14530 (tufA)
Exosome [BR:sne04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPN23F14530 (tufA)
  Exosomal proteins of breast cancer cells
   SPN23F14530 (tufA)
  Exosomal proteins of colorectal cancer cells
   SPN23F14530 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: CAR69239
UniProt: B8ZL95
LinkDB All DBs
Position
complement(1408400..1409596)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGIV
KVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtactatcggacac
gttgaccacggtaaaactaccctaactgcagctatcacaactgttttggcacgtcgcttg
ccttcatcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagaacgc
gaacgcggtatcactatcaacactgcgcacgttgagtacgaaactgaaaaacgtcactac
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgct
caaatggacggagctatccttgtagtagcttcaactgacggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
gttgacttggttgacgacgaagaattgcttgaattggttgaaatggaaatccgtgaccta
ttgtcagaatacgacttcccaggtgacgatcttccagttatccaaggttcagcacttaaa
gctcttgaaggtgactctaaatacgaagacatcgttatggaattgatgaacacagttgat
gagtatatcccagaaccagaacgtgacactgacaaaccattgcttcttccagtcgaggac
gtattctcaatcactggacgtggtacagttgcttcaggacgtatcgaccgtggtatcgtt
aaagtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactcaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgctggagataacgtaggt
gtccttcttcgtggtgttcaacgtgatgaaatcgaacgtggacaagttatcgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtctacatccttactaaagaagaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtactact
gacgttacaggttcaatcgaacttccagcaggtactgaaatggtaatgcctggtgataac
gtgacaatcgacgttgagttgattcatccaatcgccgtagaacaaggtactacattctct
atccgtgagggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system