KEGG   Streptococcus pneumoniae 70585: SP70585_1137Help
Entry
SP70585_1137      CDS       T00872                                 

Definition
(GenBank) D-alanine--D-alanine ligase B (D-alanylalanine synthetaseB) (D-Ala-D-Ala ligase B)
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SP70585_1137
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SP70585_1137
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SP70585_1137
Enzymes [BR:snm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SP70585_1137
Peptidoglycan biosynthesis and degradation proteins [BR:snm01011]
 Precursor biosynthesis
  Amino acid ligase
   SP70585_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1037153..1038118
Genome map
AA seq 321 aa AA seqDB search
MAIIKKIVVLYGGLSEEREVSENSAKEISKSLLTLGYDVISIDLSQDCSYEIGEIEKSER
GLNKQKVEIGSGIIDVCRKVDIVFLATHGGIGENGKLQAIFDVEKIDYTGNSFLSTAISM
DKKLSKIVASSVGIKCASNLMVDRIQANDFPIVIKPIRSGSSKGIKILQNKKQFDIYYKE
HPELGSFFVEKYIKGREFSVGILGETVLPVIEIKVKNGFYDYNNKYTVGAAEEVVPAKIS
EKLTHTLQKSAYKIHKALGFNVYSRTDFIVDEKGDVYFIESNSLPGMTKTSLLPQEAKAA
GIDFPNLCERIIELSREIRSQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctattattaaaaaaattgttgtactatatggtggccttagcgaagagagagaggtg
tcagaaaattctgcaaaggagattagtaaaagtctattaacattggggtacgatgtgatt
tctatagatttatctcaagactgttcgtacgagataggagaaattgaaaaaagtgagcgc
ggattaaataaacaaaaagttgagattggttcgggtattattgatgtttgtagaaaggtt
gatatagttttcttagcaactcatggcggaataggtgagaatgggaaactacaggctatt
tttgatgtagaaaaaatagactatacaggaaattcgtttcttagtacagctattagcatg
gataaaaaattatcaaaaatagtggctagttctgttggaataaaatgtgcttcgaacttg
atggttgatagaattcaggcaaatgattttcctattgttataaagccaattagaagtggt
tcaagtaaaggtattaagatacttcaaaataaaaaacaatttgacatttattataaagag
catcctgaacttggttcattctttgtagaaaagtatattaaggggagagaattttcggta
ggtattttaggtgaaactgttttaccggttattgaaataaaagtaaaaaatggtttttat
gattataataacaagtacactgttggtgcagctgaagaagtcgttcccgcaaaaatatct
gaaaagttaactcataccttacaaaaatccgcatataaaatacataaggctcttggattt
aatgtttattcacgtactgattttattgtagatgagaagggggatgtatattttattgaa
tcaaatagtttaccaggtatgactaaaacaagtttattaccacaggaagcgaaagcagct
ggtatagatttcccaaacctatgtgaacgtattattgagctgagtagggaaattagatct
caatag

DBGET integrated database retrieval system