KEGG   Streptomyces noursei: SNOUR_05275Help
Entry
SNOUR_05275       CDS       T04806                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
snr  Streptomyces noursei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1211214..1212275
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVSPMLAKSVAKIPAGMQYEAKWDGFRVIVFRDGDEVEIASRTTKSLSRYFPE
VLAAARAELPPRCVLDGEIVIAHDGRLHFEELLERIHPADSRVRTLAARTPASLVAFDLL
ALDSASLLDEPQTARREALVEAVRPARAPVHLAPATTDRELAQRWFAQFEGAGLDGVIAK
PPDLPYRPGERVMYKVKHARTADCVVAGYRLHKSGPVVGSLLLGLHDDAGHLQHVGVCAS
FPMARRRALVEELAPLRMDDATGHPWGAWADEAAHAGRRMPGGPSRWSGGKDLSWVPLRP
ERVCEVGYDHMEGSRFRHTAQFRHWRPDRTPESCTYAQLEEPVGYDLGELLGD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgcccccggtctcccccatgctcgccaagtcggtggcgaagatc
cccgccggcatgcagtacgaggccaagtgggacggcttccgcgtcatcgtgttccgggac
ggcgacgaggtcgagatcgccagccgcaccaccaagtccctcagccgctacttccccgag
gtgctggccgcggcgcgggccgaactcccgccgcgctgcgtgctggacggcgagatcgtc
atcgcgcacgacggccggctgcacttcgaggaactgctggagcgcatccacccggccgat
tcccgggtgcggacgctggccgcccgcacgcccgcctcgctggtcgccttcgacctgctg
gcgctggactccgcttcgctgctggacgaaccgcagaccgcccgccgggaagccctggtc
gaggcggtgcggccggcccgggcgccggtgcacctcgcgcccgccaccaccgaccgggag
ctggcgcagcggtggttcgcgcagttcgagggggccgggctggacggggtgatcgccaaa
ccgccggacctgccgtaccggccgggcgagcgggtgatgtacaaggtcaagcacgcccgg
accgccgactgcgtggtcgcgggctaccggctgcacaagagcgggccggtggtcggctcg
ctgctgctcggactgcacgacgacgccgggcacctccagcacgtcggggtgtgcgcgtcg
ttccccatggcccggcggcgcgccctcgtcgaggagctggcaccgctgcggatggacgac
gccaccgggcacccctggggcgcgtgggccgacgaggcggcgcacgccggccgccggatg
ccgggcgggccgagccgctggagcggcggcaaggacctgtcgtgggtgccgctgcgcccg
gagcgggtgtgcgaggtgggctacgaccacatggagggcagccggttccggcacaccgcg
cagttccgccactggcgtcccgaccgtacgccggagagctgcacctacgcgcagttggag
gagccggtcggctacgacctgggcgagctgctcggcgactga

DBGET integrated database retrieval system