KEGG   Streptomyces noursei: SNOUR_23450Help
Entry
SNOUR_23450       CDS       T04806                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
snr  Streptomyces noursei
Pathway
snr00473  D-Alanine metabolism
snr01100  Metabolic pathways
snr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:snr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SNOUR_23450 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SNOUR_23450 (alr)
Enzymes [BR:snr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SNOUR_23450 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:snr01011]
 Precursor biosynthesis
  Racemase
   SNOUR_23450 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANZ17959
UniProt: A0A1B2GVM1
LinkDB All DBs
Position
5287935..5289122
Genome map
AA seq 395 aa AA seqDB search
MNETAKRARAVIDLAAVRSNVHALRSLAPRAQLMAVVKSDAYGHGAIRCARAAREAGAPW
LGVALPEEALALRAAGDTGRLLCWLWTPGGPWGQAIEQDVDVSVSGMWALREVVAAARDR
GRVARVQLKIDTGLGRNGCQPADWTELTAAARAAEAEGVLAVTGVWSHFACADEPGHPSI
AAQLAEFRRALAVAEAAGLRPEVRHIANTPALLTLPEAHFDLVRTGIGIYGVSPSPEVGT
PEDFGLRQAMTLEASLASVKRVPGGHGVSYGHHYTTPGETTLALVPLGYADGIPRHASGT
GPVLVAGKWRTVAGRVAMDQFVVDLGGDHAEAGEPAVLFGPGDQGEPSAEDWARAAGTIG
YEIVTRIGKRVPRVYVDSEVPDRPTEDTALTGGVA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacagcgaagcgagcccgtgccgtcattgacctcgccgccgtgcggtcgaac
gtccatgcactgcggagcctcgccccccgtgcgcagctgatggccgtcgtcaagtccgac
gcctacggacacggcgcgatccgctgtgcccgcgccgctcgcgaggccggtgcgccctgg
ctgggcgtggcgctccccgaggaggcgttggcgctgcgtgcggccggggacaccggccgt
ctgctgtgttggctgtggacgccgggcgggccctggggccaggcgatcgagcaggacgtc
gatgtctcggtgagcggtatgtgggcgctgcgggaggtggtggccgcggcccgcgaccgc
ggccgggtcgcccgcgtccagctcaagatcgacaccggtctggggcgcaacggctgccag
ccggcggactggacggagctgaccgccgccgcccgcgccgccgaggcggagggcgtgctc
gcggtcaccggtgtctggtcgcacttcgcctgtgccgacgagcccgggcacccgtcgatc
gccgcccagctggcggagttccgccgggcgctggcggtcgccgaggcggccgggctgcgt
ccggaggtgcggcacatcgccaacaccccggcgctgctcaccctccccgaggcccacttc
gacctggtgcggacggggatcgggatctacggcgtgtcgcccagccccgaggtggggacg
ccggaggacttcgggctgcggcaggcgatgacgctggaggcgtcgctggcgtcggtcaag
cgggtgccgggcgggcacggggtgtcgtacgggcaccactacacgacgccgggggagacg
accctggcgctggtcccgctggggtacgccgacggcatcccgcggcacgcctcggggacg
gggccggtgttggtcgccgggaagtggcggacggtcgcggggcgggtcgcgatggaccag
ttcgtcgtcgatctgggcggggaccacgccgaggccggcgagcccgcggtgctgttcggg
cccggcgaccagggcgagccgagcgcggaggactgggcgcgggcggccgggacgatcggg
tacgagatcgtcacccggatcgggaagcgggtgccgcgcgtctatgtggacagcgaggtg
ccggaccggcccacggaggacacggcgctgacggggggtgtggcatga

DBGET integrated database retrieval system