KEGG   Streptomyces noursei: SNOUR_33110Help
Entry
SNOUR_33110       CDS       T04806                                 

Definition
(GenBank) Isocitrate dehydrogenase (NADP)
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
snr  Streptomyces noursei
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:snr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOUR_33110
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SNOUR_33110
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SNOUR_33110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7483914..7486136
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVEAYAATAGVTLETRDISLSGRIIASFPERLKEDQ
RIADALAELGQLAKTPGANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDDPKTDEER
ETRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGEND
FRSTEKSAVIAEDGSLRIELVAEDGTTTVLRESVPVLAGEVVDASVMRVAQLREFLAAQV
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFARYGEALAAAGLTPNDGLGGI
FKGLEALPDGAEIKASFDAELAEGPELAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGIYQAVIDDCRAHGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEVAVAGTVRLVDAQGNVVIEQAVAAGDIFRACQTKDAPIKDWVKLAVSRARATGD
PAVFWLDETRAHDAQLIAKVNAYLSEHDTEGLEIKILAPVEATAFSLERIRRGANTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTDNTRAKVLADTLDRATGSFLNENRSPSRKLGGIDNRGSHFY
LALYWAQELAKQTDDAQLAEAFGPLAKTLTEQEQTIVDELIAVQGSPVDIGGYYRPDPAK
ASAVMRPSKTLNQALAALQG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatttacacccacactgacgaggccccggccctggcgacgtac
tcgttcctgccggtggtggaggcgtacgccgcgacggccggggtgacgctggagacccgc
gacatctccctgtcgggccggatcatcgccagcttccccgagcgcctgaaggaggaccag
cggatcgccgacgccctcgcggagctcggccagctggccaagacccccggcgcgaacatc
atcaagctgccgaacatctcggcctccatcccgcagctcaaggcggccatcgccgagctc
caggagcagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gagacccgcgcccgctacgacaaggtcaagggcagcgccgtcaaccccgtgctgcgcgag
ggcaattcggaccgccgggcgcccgcgtcggtgaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggaccgccgactccaagaccaacgtcgcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgcagtgatcgccgaggacggctccctgcgcatcgagctg
gtggccgaggacggcaccaccaccgtgctgcgcgagtcggttccggtgctcgcgggcgag
gtggtggacgcctccgtcatgcgcgtcgcccagctccgtgagttcctcgccgcccaggtc
gcgcgcgccaaggcggagggcgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtcgtacgggccttcttccccaagaccttcgcc
cggtacggcgaggcgctggccgcggccggcctcaccccgaacgacggcctcggcggcatc
ttcaagggcctggaggcgctgcccgacggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgaccggggcatcaccaacctgcac
gtccccagcgacgtcatcgtggacgcgtccatgcccgcgatgatccgcacctccggccac
atgtggggtccggacggacaggaggcggacaccctcgcggtgctccccgacagcagctac
gccggcatctaccaggccgtcatcgacgactgccgggcgcacggcgcgttcgacccggcc
accatgggctcggtgccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgaggtcgcggtcgcgggcaccgtccgcctggtcgacgcgcagggc
aacgtcgtcatcgagcaggccgtcgccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatcaaggactgggtcaagctggccgtcagccgcgcccgcgccaccggcgac
ccggcggtgttctggctcgacgagacccgcgcgcacgatgcccagctgatcgcgaaggtc
aacgcctacctgtcggagcacgacaccgagggcctggagatcaagatcctggccccggtc
gaggcgaccgcgttctccctggagcggatccgccgcggcgcgaacaccatctcggtcacc
ggcaacgtcctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctctcggtcgtcccgctgatgaacggcggcggcctgttcgagaccggtgcc
ggtggttccgcccccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
agcctgggcgagttcctcgcgctggcggtcagcttcgagcacctcgcgacgaccacggac
aacacccgtgccaaggtcctcgccgacaccctcgaccgcgcgaccggttcgttcctcaac
gagaacaggtcgccgagccgcaagctgggtggcatcgacaaccgcggcagccacttctac
ctggcgctctactgggcccaggagctggccaagcagaccgacgacgcgcagctcgccgag
gcgttcgggccgctggccaagacgctgaccgagcaggagcagaccatcgtcgacgagctg
atcgcggtgcagggctccccggtcgacatcggcggctactaccgccccgacccggccaag
gcgtccgcggtgatgcgtccctcgaagacgctgaaccaggcgctggcggccctgcagggc
tga

DBGET integrated database retrieval system