KEGG   Streptomyces noursei: SNOUR_38310Help
Entry
SNOUR_38310       CDS       T04806                                 

Definition
(GenBank) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
snr  Streptomyces noursei
Brite
Enzymes [BR:snr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     SNOUR_38310
Peptidases [BR:snr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   SNOUR_38310
Exosome [BR:snr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNOUR_38310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8639214..8640005)
Genome map
AA seq 263 aa AA seqDB search
MARSWLRRGAAAVAVCGAVLTPVPPATAAGGPVVPDTRIVGGRNADVRDVPWQVSLRSRG
GHICGGSIIRADAVVTAAHCTVGAPPDSLSVQAGSSVRGSGGQIVPVARVLRHPKFNAAT
IDYDVAVLELASPLDFGAGVRAVPLLPEGREPITGTPATVTGWGATRDGGALPERLRRVD
VPKLSDTYCKRAYGTSSITPRMTCYGYERGRKDACQGDSGGPLVVDGYLAGIASWGTGCA
SPGHPGVYTKVSDPSIHAYITRP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacggtcatggctgcggcgaggggcggcagcggtcgcggtgtgcggtgcggtgctg
acgccggttccaccggcgacggcggcgggcggtccggtggtgccggacacccgcatcgtg
ggcgggcggaacgcggacgtgcgggacgtgccgtggcaggtgtcgttgcgcagccgcggc
ggacacatctgcggtggttcgatcatccgcgccgatgcggtggtgaccgcggcgcactgc
accgtgggggcgccgccggactcattgagcgtccaggcgggcagcagcgtgcgcgggtcg
ggcgggcagatcgtgccggtggcgcgggtgttgcggcacccgaagttcaacgcggccacg
atcgactacgacgtggcggtgctggagctggcgtccccgctggatttcggggccggggtg
cgcgcggttccgctgctgccggagggcagggagccgatcaccggcacaccggcgacggtc
accggctggggtgcgacgcgggacggcggcgcactgccggagcggctgcggcgggtcgat
gtgcccaagctcagcgacacgtactgcaagagggcgtacgggacatcctcgatcaccccg
cggatgacgtgctacggctacgagcgcgggcgcaaggacgcgtgccagggcgacagcggg
ggcccgctggtggtggacgggtatctggcggggatcgcgtcatgggggacggggtgcgcc
tcgcccgggcatcccggcgtctacaccaaggtcagcgatccgtcgatccacgcgtacatc
acccggccgtag

DBGET integrated database retrieval system