KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1974Help
Entry
SPT_1974          CDS       T00875                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
snt00220  Arginine biosynthesis
snt00250  Alanine, aspartate and glutamate metabolism
snt00290  Valine, leucine and isoleucine biosynthesis
snt01100  Metabolic pathways
snt01110  Biosynthesis of secondary metabolites
snt01130  Biosynthesis of antibiotics
snt01210  2-Oxocarboxylic acid metabolism
snt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPT_1974
   00290 Valine, leucine and isoleucine biosynthesis
    SPT_1974
   00220 Arginine biosynthesis
    SPT_1974
Enzymes [BR:snt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPT_1974
    2.6.1.66  valine---pyruvate transaminase
     SPT_1974
Amino acid related enzymes [BR:snt01007]
 Aminotransferase (transaminase)
  Class I
   SPT_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: ACO23640
LinkDB All DBs
Position
complement(1847968..1849182)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLASDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gtattggaagaagccatgcggatgcgagcgaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggctttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggctattctaactccaaagggattttctcagcccgtaaggcc
atcatgcagtattgccagctgaagaaattcccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagtgagttgattgtcatgtccatgcaggggcttttggacaatggggat
gaggtcttagtgccaatgccagactatcctctatggacggcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgtggaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaattgtccttatcaatccaaataaccca
actggagccctttatcctaaggaactcttgctggagattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatctatgaccgcatggtaatggacggacatgtgcat
acgcctgtggcgagcttggcatcagatgtcttctgtgtcagcatgaatggtctgtcaaaa
tcccaccgcatagcaggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtacaaacttccttggggggtcaccaatcagtcgatgaattgctt
cttcctggtggacgaatctacgagcaaagaaatttcatctataatgccattcaagatatt
ccaggtttgtctgccgttaaacccaaggcggggctctatatcttcccaaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgttgatgagttagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system