KEGG   Streptomyces niveus: BBN63_04690Help
Entry
BBN63_04690       CDS       T04887                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
snw  Streptomyces niveus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1123876..1124907)
Genome map
AA seq 343 aa AA seqDB search
MASKGAAVELEVGGRTVRLSSPDKIYFPDRGFTKLDVAHYYIAVGEGITRALRDRPTTLQ
RYIEGIGGESFYQKRAPKNLPDWIPTARIAFPSGRSADEICPTEPAAVLWAANLGTLTFH
PWPVRRGDTEHPDELRIDLDPQPGTDFKDAVAAAHELHGLLDEQGLNGRPKTSGGRGLHV
FVPIEPRWTFTQVRRAAIAVGRELERRMPGRVTTAWWKEERGERIFVDYNQTARDRTIAS
AYSVRPNQYATVSAPLRWDELDDVAPRDFDIETMQTRFAEIGDPHADMDADAFSLEGLLE
LAARDERDHGHGDLPYPPDYPKMPGEPKRVQPSRARPDPPDMP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagggcgcggcggtggagctggaagtcggcgggcggacggtgcggctgtcc
agcccggacaagatctactttcccgatcggggcttcaccaagctggacgtcgcccattac
tacatcgcggtgggggaggggatcacccgcgccctgcgggaccggccgaccaccctccag
cgctacatcgagggcatcggcggcgagtccttctaccagaagcgggcgcccaagaacctg
cccgactggatccccaccgcccgtatcgccttccccagcggacgctccgccgacgagatc
tgccccaccgaaccggccgccgtcctgtgggcggcgaacctcggcaccctgaccttccac
ccctggcccgtacggcgcggggacaccgagcaccccgacgagctgcgcatcgacctggac
ccgcagccgggcaccgacttcaaggacgccgtcgcggccgcgcacgaactgcacggcctc
ctggacgagcagggcctcaacggcaggcccaagacctccggcggacgcggactgcacgtc
ttcgtgccgatcgaaccgcgctggaccttcacccaggtacggcgcgccgcgatcgccgtc
ggcagggagctggaacggcgcatgccgggccgggtcaccacggcgtggtggaaggaggag
cgcggcgagcggatcttcgtggactacaaccagacggcgcgcgaccgcaccatcgcgtcg
gcctactcggtgcgccccaaccagtacgccaccgtctccgcgccgctgcgctgggacgag
ctggacgacgtggccccgcgcgacttcgacatcgagacgatgcagacccgcttcgccgaa
atcggcgatccgcacgcggacatggacgcggacgcgttcagcctggagggtctgctggag
ctggcggcgcgggacgagcgggaccacggccatggggatctgccgtacccgccggactat
ccgaagatgccgggcgaaccgaagcgcgtccagccgagccgcgcgcgccccgaccccccg
gacatgccctga

DBGET integrated database retrieval system