KEGG   Solenopsis invicta (red fire ant): 105205562Help
Entry
105205562         CDS       T03916                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
Enzymes [BR:soc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105205562
Peptidases [BR:soc01002]
 Metallo Peptidases
  Family M2
   105205562
Exosome [BR:soc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105205562
CD molecules [BR:soc04090]
 Proteins
  105205562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MQGTSVLPVRWTAFVLCLLSTVSGQLDLPPYRGDDTSRQIPPYRGNDADRQLPSYRDNDV
GRQIPSYRDEDIGRPIPSYRDDDVGRPLPPNEINYQNILARLDFLGAERCSANVIAQWAY
ETNVNEYTQLQALDAQRLYADFQYQAWLLISRIDLNSIRDPIIRRRLRYLSAVGPSALPP
DQLDRYNRLINDMLAIYNAATICAYNDPFRCGLRLYPDVSQIMAKSRDWDELQYVWTEWR
RRSGRPIRDLYIQLVTLTNDAARMNNFTDAADYWMFPYESPNFQQDVDEAWESIRPLYEE
LHAYVRRKLRDLYGPEKIGGHSPLPSHILGNIWGQSWTNLLDVTLPYPGKTYPDVTREMQ
AQGYTPIDMIRVAEEFYLSLNLSAMPPEFWAGSIVADPGDRPLICQASAWDFCNRIDYRI
KMCTKVTMKDLITLHHEMGHIQYFLRYSGLPREFRDGANPGFHEAVGEAVALSVATPQHL
QTLGLANTFIDERSADINYLFSLAMDKLVLLPFSIAMDRWRWDVFRGFINKEEYNCHWHR
LIEQYTGTKPPVLRSEDDFDPGAKYHIPANIPYIRNFVAGVLQFQLYRALCQAAGQRSEV
DNPRRPLHRCDFYRSPASGRILGRLMERGSSIPWQETLREATGEFRLDGSALREYFRPLE
DWLRTENLRTGEVVGWSYDGDFCKRSIETAGLQVYGSGLYYNSGTSVSASWIASGIMMTL
WILSTVY
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaactagtgtacttccagtaagatggacagcgttcgtactttgcctattatcg
acagtttctggtcaattggatttgccgccgtacagaggcgatgatactagccgacagata
ccaccgtacaggggcaatgatgctgaccgacagttgccgtcgtacagggacaacgacgtt
ggccgacaaataccatcgtacagggacgaagatattggccgaccgataccatcgtacagg
gacgatgatgttggccgaccattgccaccaaacgaaataaattatcagaatatcttagct
agattagacttcctgggcgcagagaggtgtagtgccaatgtgatagctcagtgggcatac
gaaaccaacgtcaacgagtacacgcagctgcaagcgctggatgcccaacgcttgtacgcg
gacttccaataccaagcgtggcttttaatctccagaatcgacctaaattctatccgagat
cctatcatcaggcgacgtcttcgttatttgtccgcagtgggcccttcggcactgccacct
gatcaattggacaggtacaatcgcctgatcaacgacatgcttgcgatttataacgcggcg
accatatgcgcttacaacgatccgttccggtgcgggctgcgtttatatccagatgtatcg
caaatcatggcgaaaagtcgggactgggacgaactgcagtacgtctggaccgagtggaga
agacgaagcggcaggccgattagggatttgtacatacagctcgttacgctgaccaatgat
gctgcaagaatgaataactttactgatgccgccgactattggatgttcccttacgagtct
cctaatttccaacaggacgttgacgaggcttgggaatcgatacgtccgctttatgaagaa
ctgcacgcttatgttcgcagaaagctgagagatctctacggtcctgaaaaaattggcgga
cactcgcctcttccgtctcacatccttggtaacatatggggacagtcttggaccaatctt
ttggatgttactttgccatatcccgggaaaacatatcctgacgttacgcgtgaaatgcag
gctcaaggctatacacccattgacatgattcgggtggccgaggaattctatctgtcctta
aacttgagcgcaatgccgccggaattctgggctggaagcatagtcgctgatcctggcgac
cgtccattaatctgccaggcgtccgcatgggacttttgcaatcgcatagactacagaatc
aaaatgtgtaccaaggtgacgatgaaggatttaataactttgcatcacgaaatgggacac
attcaatacttcttgcggtacagcggtctacctcgcgaattccgtgacggcgctaatcca
ggcttccacgaggcagtcggcgaagctgtcgccttgagcgtcgcgacgccgcagcatctg
caaactctgggcctggcaaacacgttcatcgacgagcgatccgcggacatcaactacctc
ttctccttggcgatggataaactagtgctactgcccttcagcatcgcgatggacaggtgg
cgatgggatgtcttccgcggcttcatcaacaaggaggagtacaattgtcactggcacagg
ctgattgagcagtacacgggcacgaagccgccggtcctgcgatccgaggacgacttcgat
ccaggcgcgaaatatcacatcccagccaatatcccctacatacggaatttcgtggccgga
gtcctccagttccagctgtatcgcgcgctgtgccaggctgcgggacagaggtccgaagtc
gacaacccgaggaggccgctgcacagatgcgacttctacagaagccccgcgtccggcagg
atcttggggagattgatggagaggggctcgtccatcccgtggcaggaaacgttgcgggaa
gctaccggcgagttcagattagacggatccgctcttagggagtacttccggccattagag
gactggttgagaaccgagaatttgagaacgggcgaagtagtcggctggtcatacgatgga
gacttttgtaagaggagcatagagaccgcgggcctgcaggtttacggcagtggcttgtac
tacaatagcggcacatccgtctccgcatcttggatcgcgtcaggaattatgatgactctt
tggattttatcaacggtctattga

DBGET integrated database retrieval system