KEGG   Spinacia oleracea (spinach): 110775512Help
Entry
110775512         CDS       T05137                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
soe  Spinacia oleracea (spinach)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:soe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110775512
   00051 Fructose and mannose metabolism
    110775512
   00052 Galactose metabolism
    110775512
   00500 Starch and sucrose metabolism
    110775512
   00520 Amino sugar and nucleotide sugar metabolism
    110775512
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    110775512
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110775512
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    110775512
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    110775512
  Digestive system
   04973 Carbohydrate digestion and absorption
    110775512
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    110775512
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    110775512
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110775512
Membrane trafficking [BR:soe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110775512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MRKAAVGAAVVCTAAVCAAAAVLVRQRMKSSSKWGRVMAILKELDDNCGTPLGKLRQVAD
AMTVEMHAGLASEGASKLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKR
VVEQEFDEVSIPPELMVGTSEQLFDYIAEALAKFVATESEGLHPEPNKQRELGFTFSFPV
KQTSIASGTLIRWTKGFNIEDTVGEDVVAELTKAMLRKGVDMRVTALVNDTVGTLAGGRY
YKEDVIAAVILGTGTNAAYVERASAIHKWHGPLPKSGEMVINMEWGNFRSSYLPLTEYDI
ALDEESLNPGEQIFEKMISGMYLGEIVRRVLYRMADEASLFGDTVPSKLKTPFILRTPDM
SAMHHDTSPDLKVVASKLKDVLGIPNSSLKVRKIIVDVCDVIASRGACISAAGILGIIKK
LGRDTLKQGENQKSVIALDGGLFEHYAKFRECMEDSLKELLGDEVAETIVIEHSNDGSGI
GAALLAASHSQYLEEDES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcagcggtcggagcagcggtggtatgtacagcggcggtgtgtgcggcggca
gcggtgttggtaagacagaggatgaagagctcaagcaagtggggtcgtgtaatggcaata
ctgaaggagttagatgacaattgtgggacccctttgggtaagcttagacaggtggctgat
gctatgaccgttgagatgcacgctggtcttgcatctgagggtgcttctaagctcaagatg
ctcatcagctacgttgacaatctccccactggggacgagcatggactgttctatgcgtta
gaccttggcggcaccaacttccgagtgcttcgagtaaagttgggtggcaaagaaaaacgt
gttgtcgaacaagaatttgacgaagtatcaattccacctgagttgatggttggtacatca
gaacaactgtttgattatatcgccgaagccctagccaaatttgttgcaacggaaagtgaa
ggtcttcatcctgaacccaataaacagagagagctgggatttaccttctctttccctgtc
aagcagacatcaatcgcatcagggactcttataagatggaccaagggctttaatatagaa
gatacagttggtgaagatgtggtggctgaattgaccaaggccatgctaagaaaaggtgta
gatatgcgtgtgacagctttggtcaacgatacagttggaaccctagctggaggtaggtac
tataaagaagatgtaattgctgctgttatattgggtactggaacaaacgcagcttacgtt
gaacgtgctagtgcaattcacaagtggcatggtcctttgcccaaatcaggggagatggta
attaacatggagtggggtaatttccgttcatcgtatttacctttgactgaatatgacata
gcactagatgaagaaagtttgaatcctggtgaacagatatttgagaaaatgatatcagga
atgtacttgggtgagattgtgcgaagagtcttgtataggatggcagacgaggccagcctt
tttggtgatacagtcccatcaaaattgaaaactccattcatcttaaggacaccagacatg
tctgccatgcatcatgacacatcacctgatcttaaagttgttgcgagcaaactgaaggat
gtccttgggataccaaactcatcattaaaggtgcgaaagattatagttgacgtatgtgac
gtcattgcttcacgtggggcctgcatttctgcagccgggatcttgggtattattaagaaa
ctagggagagacacattgaagcaaggtgagaaccagaagtctgtgattgcattagatgga
gggttgtttgagcactacgccaaattccgggagtgcatggaggactctttgaaggagctc
ctaggcgatgaagtcgctgaaactattgtaattgagcactcaaatgatggatcaggcatt
ggtgctgctcttctagcagcgtcgcattcccagtacctcgaggaagatgaatcttga

DBGET integrated database retrieval system