KEGG   Spinacia oleracea (spinach): 110775512Help
Entry
110775512         CDS       T05137                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00010  Glycolysis / Gluconeogenesis
soe00051  Fructose and mannose metabolism
soe00052  Galactose metabolism
soe00500  Starch and sucrose metabolism
soe00520  Amino sugar and nucleotide sugar metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
soe01200  Carbon metabolism
Module
soe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
soe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:soe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110775512
   00051 Fructose and mannose metabolism
    110775512
   00052 Galactose metabolism
    110775512
   00500 Starch and sucrose metabolism
    110775512
   00520 Amino sugar and nucleotide sugar metabolism
    110775512
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110775512
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110775512
Membrane trafficking [BR:soe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110775512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110775512
NCBI-ProteinID: XP_021835803
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MRKAAVGAAVVCTAAVCAAAAVLVRQRMKSSSKWGRVMAILKELDDNCGTPLGKLRQVAD
AMTVEMHAGLASEGASKLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKR
VVEQEFDEVSIPPELMVGTSEQLFDYIAEALAKFVATESEGLHPEPNKQRELGFTFSFPV
KQTSIASGTLIRWTKGFNIEDTVGEDVVAELTKAMLRKGVDMRVTALVNDTVGTLAGGRY
YKEDVIAAVILGTGTNAAYVERASAIHKWHGPLPKSGEMVINMEWGNFRSSYLPLTEYDI
ALDEESLNPGEQIFEKMISGMYLGEIVRRVLYRMADEASLFGDTVPSKLKTPFILRTPDM
SAMHHDTSPDLKVVASKLKDVLGIPNSSLKVRKIIVDVCDVIASRGACISAAGILGIIKK
LGRDTLKQGENQKSVIALDGGLFEHYAKFRECMEDSLKELLGDEVAETIVIEHSNDGSGI
GAALLAASHSQYLEEDES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcagcggtcggagcagcggtggtatgtacagcggcggtgtgtgcggcggca
gcggtgttggtaagacagaggatgaagagctcaagcaagtggggtcgtgtaatggcaata
ctgaaggagttagatgacaattgtgggacccctttgggtaagcttagacaggtggctgat
gctatgaccgttgagatgcacgctggtcttgcatctgagggtgcttctaagctcaagatg
ctcatcagctacgttgacaatctccccactggggacgagcatggactgttctatgcgtta
gaccttggcggcaccaacttccgagtgcttcgagtaaagttgggtggcaaagaaaaacgt
gttgtcgaacaagaatttgacgaagtatcaattccacctgagttgatggttggtacatca
gaacaactgtttgattatatcgccgaagccctagccaaatttgttgcaacggaaagtgaa
ggtcttcatcctgaacccaataaacagagagagctgggatttaccttctctttccctgtc
aagcagacatcaatcgcatcagggactcttataagatggaccaagggctttaatatagaa
gatacagttggtgaagatgtggtggctgaattgaccaaggccatgctaagaaaaggtgta
gatatgcgtgtgacagctttggtcaacgatacagttggaaccctagctggaggtaggtac
tataaagaagatgtaattgctgctgttatattgggtactggaacaaacgcagcttacgtt
gaacgtgctagtgcaattcacaagtggcatggtcctttgcccaaatcaggggagatggta
attaacatggagtggggtaatttccgttcatcgtatttacctttgactgaatatgacata
gcactagatgaagaaagtttgaatcctggtgaacagatatttgagaaaatgatatcagga
atgtacttgggtgagattgtgcgaagagtcttgtataggatggcagacgaggccagcctt
tttggtgatacagtcccatcaaaattgaaaactccattcatcttaaggacaccagacatg
tctgccatgcatcatgacacatcacctgatcttaaagttgttgcgagcaaactgaaggat
gtccttgggataccaaactcatcattaaaggtgcgaaagattatagttgacgtatgtgac
gtcattgcttcacgtggggcctgcatttctgcagccgggatcttgggtattattaagaaa
ctagggagagacacattgaagcaaggtgagaaccagaagtctgtgattgcattagatgga
gggttgtttgagcactacgccaaattccgggagtgcatggaggactctttgaaggagctc
ctaggcgatgaagtcgctgaaactattgtaattgagcactcaaatgatggatcaggcatt
ggtgctgctcttctagcagcgtcgcattcccagtacctcgaggaagatgaatcttga

DBGET integrated database retrieval system